(data stored in ACNUC16935 zone)

EMBL: BN001307.PE90

BN001307.PE90        Location/Qualifiers
FT   CDS             242435..243289
FT                   /locus_tag="ANIA_08975"
FT                   /old_locus_tag="AN8975.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007881"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007881"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007881"
FT                   /db_xref="GOA:Q5ARV5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV5"
FT                   /protein_id="CBF84535.1"
FT                   /translation="MDQTYNPTPSAPVIRLMVLETDKPHPDTHSERGTFGKIVHEHFAT
FT                   AGRAHKPPVGVETDQVFVVSEQGGRIPSLEEFDSFDGLLITGSLYDAHGDDEWILQLLE
FT                   LLKTLWIKRADFRFLGVCFGHQLLARLLGGSIGPAPSQDWELGHCRIALTPVGQRLFRT
FT                   RGDDNHVYLHQMHQDQVKIAPTAASAGPDMLPQDTEIAVWGHTDHTPVQGLYIPNRLFT
FT                   TQAHLAFDEDMVKRQIQIRVEKGAISDLEHADRAAETADLEHDGVEVAKAILRLFMDDE
FT                   EGQ"
     MDQTYNPTPS APVIRLMVLE TDKPHPDTHS ERGTFGKIVH EHFATAGRAH KPPVGVETDQ        60
     VFVVSEQGGR IPSLEEFDSF DGLLITGSLY DAHGDDEWIL QLLELLKTLW IKRADFRFLG       120
     VCFGHQLLAR LLGGSIGPAP SQDWELGHCR IALTPVGQRL FRTRGDDNHV YLHQMHQDQV       180
     KIAPTAASAG PDMLPQDTEI AVWGHTDHTP VQGLYIPNRL FTTQAHLAFD EDMVKRQIQI       240
     RVEKGAISDL EHADRAAETA DLEHDGVEVA KAILRLFMDD EEGQ                        284
//

If you have problems or comments...

PBIL Back to PBIL home page