(data stored in ACNUC16935 zone)

EMBL: BN001307.PE91

BN001307.PE91        Location/Qualifiers
FT   CDS             complement(join(244848..245118,245171..245297,
FT                   245715..245926,246011..246075))
FT                   /locus_tag="ANIA_08974"
FT                   /old_locus_tag="AN8974.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007882"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007882"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007882"
FT                   /db_xref="GOA:Q5ARV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV6"
FT                   /protein_id="CBF84537.1"
FT                   /translation="MSNRNPVTSTESPGSLSADKRFFDEANAAFQNDGGWYNTFVPDTA
FT                   MITRAEQGSRYQGPNLEEDEGDLAAEADAAMDANPAFGSYLDEQVEGVSDRAPSTAHLE
FT                   ILDNRSRPDSKTLAMSTNNPPEEAKEGSYGFPAWDTFESQKDGYALDRRAHLDEVERGP
FT                   AVRHKNVGERDYNRASAEGQPDTQFNKSARFSPPSLKNGEGLEETWTDADLEEFRRAAG
FT                   KR"
     MSNRNPVTST ESPGSLSADK RFFDEANAAF QNDGGWYNTF VPDTAMITRA EQGSRYQGPN        60
     LEEDEGDLAA EADAAMDANP AFGSYLDEQV EGVSDRAPST AHLEILDNRS RPDSKTLAMS       120
     TNNPPEEAKE GSYGFPAWDT FESQKDGYAL DRRAHLDEVE RGPAVRHKNV GERDYNRASA       180
     EGQPDTQFNK SARFSPPSLK NGEGLEETWT DADLEEFRRA AGKR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page