(data stored in ACNUC16935 zone)

EMBL: BN001307.PE93

BN001307.PE93        Location/Qualifiers
FT   CDS             join(250130..250699,250915..251006,251368..251834,
FT                   251901..252262,252311..252460,252509..252813,
FT                   252880..253165)
FT                   /locus_tag="ANIA_08972"
FT                   /old_locus_tag="AN8972.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007884"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007884"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007884"
FT                   /db_xref="GOA:Q5ARV8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV8"
FT                   /protein_id="CBF84541.1"
FT                   /translation="MQSPEPQPCHLPSVTIKPAPSTSPAPIQFGEFPAHSDARTGLSKM
FT                   HDGGTYSNRPEPLAPTLGLGVDSQIQAATLCSVSSTFLCLSPGRSCSHSQILKTTVSAV
FT                   GQLGKLDDSCGMYLSREDGRMVAGVWHKESPSPFPNMAQSVLARSQPRRTWPAATVLTG
FT                   LKESLFDVGRGHDWVPRGLAPAPASGNRYLLARSSGGPPRAVLDLSASSVFVNDYYSEL
FT                   FGYDQGVTGGLLELPSFYKYFPEITADMCPEDENLSSCRSQRSTNQGIAVAAYNLGCFL
FT                   GAILTVFIGNAIGRRRTIFCGCVTMTTGAILQCTAYSLPHWIVGRIVTGIGNGMNTSTV
FT                   PTWQSESAKAHDRGKLVMIEGMLITGGICLSYWINYGFAFLPDHEVSWRFPIAFQIIFA
FT                   VTIFISIMNLPESPRWLVMKGRDDEAVEILELLNEKPRDDPYIQNELLSIKETVMEMNK
FT                   GSFRSLFKMSEYREFHRVALAYVNQMFQQISGINLITYYAPNIYTDIGLGGGNTAKLMA
FT                   AANGTEYLLAAFIPIFIIEKVGRRPLMLFGAAGMSISMAILAGTHYRRETYDDTKAGVA
FT                   QAVFLFVFNTFFAIGWLGMTWLYPAEIVPLRIRAPTNALSTSANWIFNFMVVMITPVAF
FT                   ENIKHNTYTIFAVINAFMFPVVYFCFPETRYRSLEEMDAIFKKSDGIWSAVQHSIKEPY
FT                   RYDKHGQLKPEYLEEAIRRESVRHVEGKFESEDSTNESQEAKGTETRLE"
     MQSPEPQPCH LPSVTIKPAP STSPAPIQFG EFPAHSDART GLSKMHDGGT YSNRPEPLAP        60
     TLGLGVDSQI QAATLCSVSS TFLCLSPGRS CSHSQILKTT VSAVGQLGKL DDSCGMYLSR       120
     EDGRMVAGVW HKESPSPFPN MAQSVLARSQ PRRTWPAATV LTGLKESLFD VGRGHDWVPR       180
     GLAPAPASGN RYLLARSSGG PPRAVLDLSA SSVFVNDYYS ELFGYDQGVT GGLLELPSFY       240
     KYFPEITADM CPEDENLSSC RSQRSTNQGI AVAAYNLGCF LGAILTVFIG NAIGRRRTIF       300
     CGCVTMTTGA ILQCTAYSLP HWIVGRIVTG IGNGMNTSTV PTWQSESAKA HDRGKLVMIE       360
     GMLITGGICL SYWINYGFAF LPDHEVSWRF PIAFQIIFAV TIFISIMNLP ESPRWLVMKG       420
     RDDEAVEILE LLNEKPRDDP YIQNELLSIK ETVMEMNKGS FRSLFKMSEY REFHRVALAY       480
     VNQMFQQISG INLITYYAPN IYTDIGLGGG NTAKLMAAAN GTEYLLAAFI PIFIIEKVGR       540
     RPLMLFGAAG MSISMAILAG THYRRETYDD TKAGVAQAVF LFVFNTFFAI GWLGMTWLYP       600
     AEIVPLRIRA PTNALSTSAN WIFNFMVVMI TPVAFENIKH NTYTIFAVIN AFMFPVVYFC       660
     FPETRYRSLE EMDAIFKKSD GIWSAVQHSI KEPYRYDKHG QLKPEYLEEA IRRESVRHVE       720
     GKFESEDSTN ESQEAKGTET RLE                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page