(data stored in ACNUC16935 zone)

EMBL: BN001307.PE94

BN001307.PE94        Location/Qualifiers
FT   CDS             join(258411..258957,259029..259146,259215..259781,
FT                   259904..259943)
FT                   /locus_tag="ANIA_08971"
FT                   /old_locus_tag="AN8971.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G13725)"
FT                   /note="transcript_id=CADANIAT00007885"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007885"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007885"
FT                   /db_xref="GOA:Q5ARV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV9"
FT                   /protein_id="CBF84542.1"
FT                   /translation="MLESEPGLVVDHGWVLYAASWPLFGICFLIISLRLWVRAHMVRSL
FT                   GWDDAFMILAFLCAAINTILVTISVQYGTGRHASNLTEYQQSQSIKYQVLSAGFHVMST
FT                   NWGKVSVALFLIRIISEVKNHKLGMYALIIVMTIINTGAVITIFAQCQPTAAIWDHSLA
FT                   GPQACWPPDTQKKYSFFQAAASALTDLILAIYPLFTIKDLQMPTKVKLGLGFVLSLGLV
FT                   AMVAAIIKATHLPDMASYEDYTWDTINLTIWVSLEQYLIILAACIPALTPLFNIIVRRA
FT                   SNRSKSKSKSMPNDLLKGDSVTVQSLSRKHKHGSRSRGRSRDFALTLDSNSSQHQQYNP
FT                   FARVGREYVEYPLTWTTTTMHTATDLHHPADGSDSETPISGFHEEPEMPTGILRTTDFR
FT                   LEAVSNSRNSAVRWQIAKPILQDN"
     MLESEPGLVV DHGWVLYAAS WPLFGICFLI ISLRLWVRAH MVRSLGWDDA FMILAFLCAA        60
     INTILVTISV QYGTGRHASN LTEYQQSQSI KYQVLSAGFH VMSTNWGKVS VALFLIRIIS       120
     EVKNHKLGMY ALIIVMTIIN TGAVITIFAQ CQPTAAIWDH SLAGPQACWP PDTQKKYSFF       180
     QAAASALTDL ILAIYPLFTI KDLQMPTKVK LGLGFVLSLG LVAMVAAIIK ATHLPDMASY       240
     EDYTWDTINL TIWVSLEQYL IILAACIPAL TPLFNIIVRR ASNRSKSKSK SMPNDLLKGD       300
     SVTVQSLSRK HKHGSRSRGR SRDFALTLDS NSSQHQQYNP FARVGREYVE YPLTWTTTTM       360
     HTATDLHHPA DGSDSETPIS GFHEEPEMPT GILRTTDFRL EAVSNSRNSA VRWQIAKPIL       420
     QDN                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page