(data stored in ACNUC16935 zone)

EMBL: BN001307.PE96

BN001307.PE96        Location/Qualifiers
FT   CDS             join(262359..262493,262549..263064)
FT                   /locus_tag="ANIA_08969"
FT                   /old_locus_tag="AN8969.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007887"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007887"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007887"
FT                   /db_xref="GOA:Q5ARW1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW1"
FT                   /protein_id="CBF84546.1"
FT                   /translation="MKFISVLALPGLAYAAVQGFDISHYQETVDYQGAYDSGARFVMIK
FT                   ATEGTSYTDPKFSTHYSGATSAGLIRGGYHFAQPGSSSGADQASYFIEHGGGWSGDGQT
FT                   LPGMLDLEAGCYGLSTSAMSSWIKDFGETYKAATGRYPMIYTTTSWWQECTGNDSGFGE
FT                   YPLVVARWGSSVGTLPASWSTHSFWQNADTYEFGGDSEVWNGSEDSLKTFASK"
     MKFISVLALP GLAYAAVQGF DISHYQETVD YQGAYDSGAR FVMIKATEGT SYTDPKFSTH        60
     YSGATSAGLI RGGYHFAQPG SSSGADQASY FIEHGGGWSG DGQTLPGMLD LEAGCYGLST       120
     SAMSSWIKDF GETYKAATGR YPMIYTTTSW WQECTGNDSG FGEYPLVVAR WGSSVGTLPA       180
     SWSTHSFWQN ADTYEFGGDS EVWNGSEDSL KTFASK                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page