(data stored in ACNUC16935 zone)

EMBL: BN001307.PE97

BN001307.PE97        Location/Qualifiers
FT   CDS             join(263269..263494,263571..263934,264012..264360)
FT                   /locus_tag="ANIA_08968"
FT                   /old_locus_tag="AN8968.4"
FT                   /product="isoflavone reductase family protein
FT                   (AFU_orthologue; AFUA_1G12510)"
FT                   /note="transcript_id=CADANIAT00007888"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007888"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007888"
FT                   /db_xref="GOA:C8VL85"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL85"
FT                   /protein_id="CBF84548.1"
FT                   /translation="MTKSNLLIFGATGAIGSYITAAITDARDEFGRIGIFTSQSTLTKK
FT                   TKEINALREKAVDILVGDVTSKDEVLKAFDGFDTVVSALGRGVIAQQVHLVQWADESPQ
FT                   IKRFLPSEYGTDIEYSLASANEKPHQQKLKVRAAIRETKNLEYAFVVTGPYADVPFYLG
FT                   ASKNPRGGSFDVKNKKAVLLGDGNGRISLVACADVGKFVVHTLTHWDKARGRALKLNSF
FT                   TTTPNDILAEFEKQTGNKWSVEYTSLKQLKQYEKEAWEKGEPDATTLTLRRIWTEGGTL
FT                   YERRDNEDIGAENTTTLEEAVNGAIKTQLGQ"
     MTKSNLLIFG ATGAIGSYIT AAITDARDEF GRIGIFTSQS TLTKKTKEIN ALREKAVDIL        60
     VGDVTSKDEV LKAFDGFDTV VSALGRGVIA QQVHLVQWAD ESPQIKRFLP SEYGTDIEYS       120
     LASANEKPHQ QKLKVRAAIR ETKNLEYAFV VTGPYADVPF YLGASKNPRG GSFDVKNKKA       180
     VLLGDGNGRI SLVACADVGK FVVHTLTHWD KARGRALKLN SFTTTPNDIL AEFEKQTGNK       240
     WSVEYTSLKQ LKQYEKEAWE KGEPDATTLT LRRIWTEGGT LYERRDNEDI GAENTTTLEE       300
     AVNGAIKTQL GQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page