(data stored in ACNUC16935 zone)

EMBL: BN001307.PE98

BN001307.PE98        Location/Qualifiers
FT   CDS             complement(264455..265948)
FT                   /locus_tag="ANIA_08967"
FT                   /old_locus_tag="AN8967.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_6G14300)"
FT                   /note="transcript_id=CADANIAT00007889"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007889"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007889"
FT                   /db_xref="GOA:Q5ARW3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW3"
FT                   /protein_id="CBF84550.1"
FT                   /translation="MGLEQHKTAVTRIASAIRGFYERKQPFRIAHGSTNSTRPIRRKHE
FT                   VDISDLRNVLRVDPVTRTALVEPNVPMDRLVEATLKHGLVPPVVMEFPGITAGGGFAGT
FT                   AGESSSFRYGFFDRTINYVEMVLADGSIVKVSENENRDLFRGAAGAVGSLGVTTLMELQ
FT                   LVEAKKFVKATYLPQRSVRDSITNVHAATLNDANDYVDGIIYGPDHGVVVAGEMTNEMP
FT                   DSAKIQTFSKAWDPWYYLHVKAKTRGNSPVTDYIPLAEYLFRYDRGGFWVGRAAFHYFH
FT                   FPFSRVTRWWLDDFLHTRMLYKALHASGESSRFVIQDLALPYANAEKFINYTSNKLGIW
FT                   PLWLCPLKQSPAPTFHPHSSVQSPGFTEDQMLNIGVWGFGPKDPEAFVTANRELEHRLR
FT                   ELGGMKWFYAHTYYGEDEFWSMYDRKWYDELREKYNATTLPSVYDKIKIDVEADRKERH
FT                   ESWSRKVRSIWPLGGLWGIKKAIESKEYHIHRNSTWKWK"
     MGLEQHKTAV TRIASAIRGF YERKQPFRIA HGSTNSTRPI RRKHEVDISD LRNVLRVDPV        60
     TRTALVEPNV PMDRLVEATL KHGLVPPVVM EFPGITAGGG FAGTAGESSS FRYGFFDRTI       120
     NYVEMVLADG SIVKVSENEN RDLFRGAAGA VGSLGVTTLM ELQLVEAKKF VKATYLPQRS       180
     VRDSITNVHA ATLNDANDYV DGIIYGPDHG VVVAGEMTNE MPDSAKIQTF SKAWDPWYYL       240
     HVKAKTRGNS PVTDYIPLAE YLFRYDRGGF WVGRAAFHYF HFPFSRVTRW WLDDFLHTRM       300
     LYKALHASGE SSRFVIQDLA LPYANAEKFI NYTSNKLGIW PLWLCPLKQS PAPTFHPHSS       360
     VQSPGFTEDQ MLNIGVWGFG PKDPEAFVTA NRELEHRLRE LGGMKWFYAH TYYGEDEFWS       420
     MYDRKWYDEL REKYNATTLP SVYDKIKIDV EADRKERHES WSRKVRSIWP LGGLWGIKKA       480
     IESKEYHIHR NSTWKWK                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page