(data stored in ACNUC16935 zone)

EMBL: BN001307.PE99

BN001307.PE99        Location/Qualifiers
FT   CDS             complement(join(268531..268632,268738..269073,
FT                   269124..270713))
FT                   /locus_tag="ANIA_08966"
FT                   /old_locus_tag="AN8966.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007890"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007890"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007890"
FT                   /db_xref="GOA:C8VL87"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL87"
FT                   /protein_id="CBF84552.1"
FT                   /translation="MVLAQYLKRAVAWLAPPPKQSEDGRDQWPSRAAFLLAAMGGCAGQ
FT                   GNLIRYPSVVYNNYGLQWFIPYFLAIFFVAIPALILEISIGQAYRGGTVIAFNNINRRL
FT                   KGVGIGPILVSFIVTQYFTVNLAWIMNYFRNSFRSPLPWEGRIEEFYMGDVIHNVDPVG
FT                   GELSTDGKHVLSYTEYPGVRLLGETVGWSAFIWFLIWVSIFRGVGLTGRVVYWTMGLPI
FT                   VTTIIFVGRSLSLENASEGVKLLWATWRGGQLASGTVWQTAVGQVFFSTGIGFGYFTSY
FT                   ASYNAKHSNAVMDALLICGSNVLFENFAAFAVFGVVGYLHRWPEDGVRLGAFVVGFLTL
FT                   PEAVLHMPGSNFWAILLFFTLVVLGFSSAFVMLDAVATLVVDSGLKVSRPIIVTVLTLI
FT                   SFLMCLPYCTEFGFYLLDGIDRWINNICLIFVVWSEVVSASTVYRWQDVVDQTGLPAFI
FT                   TYNFAYFGGQVIGVSVAHGTENPGIGAGAGFGVYVVFSILSALLAKTPIQPAPSFWGRN
FT                   SLLSRFWYLAAYSGNQIRRDLNAIIGGEKNWKIPSVWPVLLRYVCAPVLAIIFSFAYPE
FT                   FHTLRYDPLMITGFILAHILLLIILLGLVMPRYYDVFIPPNRIDEGGRLRADLANDRII
FT                   PGGSDDGKCDNCASAPRQSGHEVAPIFLVEHLAPTYETCL"
     MVLAQYLKRA VAWLAPPPKQ SEDGRDQWPS RAAFLLAAMG GCAGQGNLIR YPSVVYNNYG        60
     LQWFIPYFLA IFFVAIPALI LEISIGQAYR GGTVIAFNNI NRRLKGVGIG PILVSFIVTQ       120
     YFTVNLAWIM NYFRNSFRSP LPWEGRIEEF YMGDVIHNVD PVGGELSTDG KHVLSYTEYP       180
     GVRLLGETVG WSAFIWFLIW VSIFRGVGLT GRVVYWTMGL PIVTTIIFVG RSLSLENASE       240
     GVKLLWATWR GGQLASGTVW QTAVGQVFFS TGIGFGYFTS YASYNAKHSN AVMDALLICG       300
     SNVLFENFAA FAVFGVVGYL HRWPEDGVRL GAFVVGFLTL PEAVLHMPGS NFWAILLFFT       360
     LVVLGFSSAF VMLDAVATLV VDSGLKVSRP IIVTVLTLIS FLMCLPYCTE FGFYLLDGID       420
     RWINNICLIF VVWSEVVSAS TVYRWQDVVD QTGLPAFITY NFAYFGGQVI GVSVAHGTEN       480
     PGIGAGAGFG VYVVFSILSA LLAKTPIQPA PSFWGRNSLL SRFWYLAAYS GNQIRRDLNA       540
     IIGGEKNWKI PSVWPVLLRY VCAPVLAIIF SFAYPEFHTL RYDPLMITGF ILAHILLLII       600
     LLGLVMPRYY DVFIPPNRID EGGRLRADLA NDRIIPGGSD DGKCDNCASA PRQSGHEVAP       660
     IFLVEHLAPT YETCL                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page