(data stored in ACNUC16935 zone)

EMBL: BN001307.PLKA

BN001307.PLKA        Location/Qualifiers
FT   CDS             join(1123585..1123911,1123966..1124408,1124473..1127104)
FT                   /gene="plkA"
FT                   /locus_tag="ANIA_01560"
FT                   /old_locus_tag="AN1560.4"
FT                   /product="Polo-like kinase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q874A0]"
FT                   /note="transcript_id=CADANIAT00008189"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008189"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008189"
FT                   /db_xref="GOA:C8VMZ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ9"
FT                   /protein_id="CBF85111.1"
FT                   /translation="MERHLQPTMEALSPRSTNQMIKPKASMERKVLDKNAAAAQKASSA
FT                   KNHAPPPPALVVEPGDDGEQYSTGAFLGKGGFAICYEGTLLRNGRVFAMKVVKSDMGQK
FT                   KMQEKFRTELQIHSKMRHPHIVGFHRAFVYDQCIYVILELCPNGSVMDMVRKRKCLSLP
FT                   EVRRFMVQLCGAVKYLHKRNVAHRDLKMGNLFLDRNMDIKVGDFGLAAMIMSEKDEKRR
FT                   KTLCGTPNYIAPEVLDRSKGGHTQKVDIWSLGVICFAMLTGYPPFQSKTQEEIYKKVRN
FT                   LTYVWPKDSECANHIPDEAKSLVSCCLNLDEQKRPEPDDIVEHAFFNMYNGCIPKRLDP
FT                   KCSVQKPTWLRGAEPQGDAMAFGHGLDFDEKFSSYIRDVDDPILRYRTCKAAFYSSCGV
FT                   GRKPDGTARKSVGHNASKSGFAECLAEEEKGLQPLMPLPEDMVYKYPHDLIGDWSVPES
FT                   LPLRRQDALADTSVLSSRSSSTSLRTNTVSQSRTQAALAAAQQRRNGSQSHAASLRQQA
FT                   LTGRGTIRKIPSLCDPPQPTMKAMPDVRDAGLNPDPVPPVPTGGLAERPIRTRRGIAAS
FT                   YSGTTSVRGMDTNAVPSVSQASNDLGMLTVGKTRSQSRKLEAANQVAVEPLRVLKDRST
FT                   STGPENLAAVSRQKSARTVHKDLGGVAARKPDSEAARREEPVTRQRTEAQPQPMSSSGS
FT                   KASLSSTNKPRSSLGLHALLHSDDPCELLPGSSIDDVKIDLRNMLSNLVPGSAARRRVV
FT                   SQRPPHAYVIKWVDYTNRYGIGYVLDDGSVGCVFKAENGQPASGVVLRDGEKHIRRKAR
FT                   SQENSDSQSWSYSEADQLVPRHGKPVEFYENCSDDLLECRGGICRALIPPSLFEVKDSS
FT                   GGVKVRMDSGISRARADAEKIKRVKLVDQFGKYMIGSLGRHGDETLLDDAATDGAPGQF
FT                   IKFYQRLGNVGVWGFGDGAFQFNFPDHTKLVLAPGRTRNSSPWMDFYHLSPTAARYLAA
FT                   KGKMHPSGFDTRAVVSDEIATFLSIAYGTSTSAMDDKIREVLDANSFLQKIAFIKDVLK
FT                   SWIRQGRLGGRPSSDKPGTEMFWEGSQERPQASGGGSSKFVWVTVGAPGGDGEYRSVSL
FT                   RDKKGNSVGENDEMEALRERLRLAGL"
     MERHLQPTME ALSPRSTNQM IKPKASMERK VLDKNAAAAQ KASSAKNHAP PPPALVVEPG        60
     DDGEQYSTGA FLGKGGFAIC YEGTLLRNGR VFAMKVVKSD MGQKKMQEKF RTELQIHSKM       120
     RHPHIVGFHR AFVYDQCIYV ILELCPNGSV MDMVRKRKCL SLPEVRRFMV QLCGAVKYLH       180
     KRNVAHRDLK MGNLFLDRNM DIKVGDFGLA AMIMSEKDEK RRKTLCGTPN YIAPEVLDRS       240
     KGGHTQKVDI WSLGVICFAM LTGYPPFQSK TQEEIYKKVR NLTYVWPKDS ECANHIPDEA       300
     KSLVSCCLNL DEQKRPEPDD IVEHAFFNMY NGCIPKRLDP KCSVQKPTWL RGAEPQGDAM       360
     AFGHGLDFDE KFSSYIRDVD DPILRYRTCK AAFYSSCGVG RKPDGTARKS VGHNASKSGF       420
     AECLAEEEKG LQPLMPLPED MVYKYPHDLI GDWSVPESLP LRRQDALADT SVLSSRSSST       480
     SLRTNTVSQS RTQAALAAAQ QRRNGSQSHA ASLRQQALTG RGTIRKIPSL CDPPQPTMKA       540
     MPDVRDAGLN PDPVPPVPTG GLAERPIRTR RGIAASYSGT TSVRGMDTNA VPSVSQASND       600
     LGMLTVGKTR SQSRKLEAAN QVAVEPLRVL KDRSTSTGPE NLAAVSRQKS ARTVHKDLGG       660
     VAARKPDSEA ARREEPVTRQ RTEAQPQPMS SSGSKASLSS TNKPRSSLGL HALLHSDDPC       720
     ELLPGSSIDD VKIDLRNMLS NLVPGSAARR RVVSQRPPHA YVIKWVDYTN RYGIGYVLDD       780
     GSVGCVFKAE NGQPASGVVL RDGEKHIRRK ARSQENSDSQ SWSYSEADQL VPRHGKPVEF       840
     YENCSDDLLE CRGGICRALI PPSLFEVKDS SGGVKVRMDS GISRARADAE KIKRVKLVDQ       900
     FGKYMIGSLG RHGDETLLDD AATDGAPGQF IKFYQRLGNV GVWGFGDGAF QFNFPDHTKL       960
     VLAPGRTRNS SPWMDFYHLS PTAARYLAAK GKMHPSGFDT RAVVSDEIAT FLSIAYGTST      1020
     SAMDDKIREV LDANSFLQKI AFIKDVLKSW IRQGRLGGRP SSDKPGTEMF WEGSQERPQA      1080
     SGGGSSKFVW VTVGAPGGDG EYRSVSLRDK KGNSVGENDE MEALRERLRL AGL             1133
//

If you have problems or comments...

PBIL Back to PBIL home page