(data stored in ACNUC13479 zone)

EMBL: BT015877.PE1

BT015877.PE1         Location/Qualifiers
FT   CDS             86..868
FT                   /codon_start=1
FT                   /product="At5g05670"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9FFK7"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK7"
FT                   /protein_id="AAU95413.1"
FT                   /translation="MENLEDLKILAEQWSHQGIEYLQKIPPNQLYAAIGVLLFTTILLF
FT                   LSIRLVRRTKSNTVLLSGLTGSGKTVLFYQLRDGSSHQGTVTSMEPNEGTFVLHSENTK
FT                   KGKIKPVHLVDVPGHSRLRPKLEEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNA
FT                   NVVKKKIPVLLCCNKTDKLTAHTKEFIRKQMEKEIEKLRASRSAVSTADIANDFTIGIE
FT                   GEVFSFTHCSNKVTVAEASGLTGETIQIEDFIREYIKP"
     MENLEDLKIL AEQWSHQGIE YLQKIPPNQL YAAIGVLLFT TILLFLSIRL VRRTKSNTVL        60
     LSGLTGSGKT VLFYQLRDGS SHQGTVTSME PNEGTFVLHS ENTKKGKIKP VHLVDVPGHS       120
     RLRPKLEEFL PQAAAIVFVV DALEFLPNCR AASEYLYEIL TNANVVKKKI PVLLCCNKTD       180
     KLTAHTKEFI RKQMEKEIEK LRASRSAVST ADIANDFTIG IEGEVFSFTH CSNKVTVAEA       240
     SGLTGETIQI EDFIREYIKP                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page