(data stored in SCRATCH zone)

EMBL: BT024797

BT024797             Location/Qualifiers
FT   CDS             1..180
FT                   /codon_start=1
FT                   /product="At4g26320"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9STQ3"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ3"
FT                   /protein_id="ABD60680.1"
FT                   /translation="MEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPA
FT                   FFASVATLAFGFLF"
     MEAMKMRLFV AVLVAAMAFS AVQQAAAVEA PAPSPTSDAS LAIPAFFASV ATLAFGFLF         59
//

If you have problems or comments...

PBIL Back to PBIL home page