(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCA_1.PE3

BURCA_1.PE3          Location/Qualifiers
FT   CDS             complement(2666..2992)
FT                   /locus_tag="Bcen_0003"
FT                   /gene_family="HOG000253752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:107021565"
FT                   /db_xref="GeneID:4091873"
FT                   /translation="MKPKTCGAAQRRESIQSVPERKSCGTIGFLRVRSAKRRTCFNGTV
FT                   GTISNLNLRDCAVRSHTRPTIQIGNLNDVPPCGGTGGPHVPPSSSTTITFGAIPSRRAS
FT                   IPVA"
FT                   /protein_id="YP_619892.1"
     MKPKTCGAAQ RRESIQSVPE RKSCGTIGFL RVRSAKRRTC FNGTVGTISN LNLRDCAVRS        60
     HTRPTIQIGN LNDVPPCGGT GGPHVPPSSS TTITFGAIPS RRASIPVA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page