(data stored in ACNUC30630 zone)

EMBL: BX251410.ACOL

BX251410.ACOL        Location/Qualifiers
FT   CDS             complement(290066..291418)
FT                   /transl_table=11
FT                   /gene="acoL"
FT                   /locus_tag="TW260"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Similar to Bacillus subtilis dihydrolipoamide
FT                   dehydrogenase AcoL SWALL:DLD3_BACSU (SWALL:O34324) (458 aa)
FT                   fasta scores: E(): 2.9e-46, 35.07% id in 459 aa"
FT                   /protein_id="CAD66936.1"
FT                   /translation="MDYDLIVLGAGSAGYATAIRATQLGMKVALAEGDKVGGTCLHRGC
FT                   IPTKSLVQCAKAAHIAKNASKFGVINSFSGVDINAVNVFKNGIVESKYRGLQSLLRSYG
FT                   IHVYPNFATLSSQNSVRIGTEDITGKNIVIATGSRPKGIPGLSGGCIFDSDSILEIDHL
FT                   PSSLAIIGGGVIGVEFASIFNYLGVDVSILEAQETLIPSEERGVSKQLERVFRRRGIKL
FT                   YLGHKIMDVSQTDGVVVSLDSNEKVNADLLLVAIGRAPATDAIGKVGIEIDGGAISVDE
FT                   KLRTTVPNVFAAGDVVGGLQLAHRGYQQGIYLAEQIAGLDPSAVADINIPRVIYTSPEV
FT                   ASVGYTEAGAAEIYGVNEIVTYEYNLAGNAKSSIMGAAGSIKVVQHKNKDVLGVHMVGD
FT                   GVSELVSEAQLIVNWEANPSDVASLIHPHPTQAEAIGEAMLALAGKPLHGI"
     MDYDLIVLGA GSAGYATAIR ATQLGMKVAL AEGDKVGGTC LHRGCIPTKS LVQCAKAAHI        60
     AKNASKFGVI NSFSGVDINA VNVFKNGIVE SKYRGLQSLL RSYGIHVYPN FATLSSQNSV       120
     RIGTEDITGK NIVIATGSRP KGIPGLSGGC IFDSDSILEI DHLPSSLAII GGGVIGVEFA       180
     SIFNYLGVDV SILEAQETLI PSEERGVSKQ LERVFRRRGI KLYLGHKIMD VSQTDGVVVS       240
     LDSNEKVNAD LLLVAIGRAP ATDAIGKVGI EIDGGAISVD EKLRTTVPNV FAAGDVVGGL       300
     QLAHRGYQQG IYLAEQIAGL DPSAVADINI PRVIYTSPEV ASVGYTEAGA AEIYGVNEIV       360
     TYEYNLAGNA KSSIMGAAGS IKVVQHKNKD VLGVHMVGDG VSELVSEAQL IVNWEANPSD       420
     VASLIHPHPT QAEAIGEAML ALAGKPLHGI                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page