(data stored in ACNUC30630 zone)

EMBL: BX251410.ADK

BX251410.ADK         Location/Qualifiers
FT   CDS             254348..254908
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="TW226"
FT                   /product="adenylate kinase"
FT                   /note="Similar to Xanthomonas campestris adenylate kinase
FT                   Adk or Xcc3291 SWALL:AAM42561 (EMBL:AE012446) (187 aa)
FT                   fasta scores: E(): 3.3e-21, 37.96% id in 187 aa, and to
FT                   Homo sapiens adenylate kinase isoenzyme 1 Ak1
FT                   SWALL:KAD1_HUMAN (SWALL:P00568) (194 aa) fasta scores: E():
FT                   3.7e-14, 32.78% id in 183 aa"
FT                   /db_xref="GOA:Q83I60"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I60"
FT                   /protein_id="CAD66903.1"
FT                   /translation="MRAIMVGPPGSGKGTQCGLIQSRLGISVIATGDVFRERMKTDMAL
FT                   RDIVSSGGYVSDSTTNRIVEDCLDKEDVSSGFVLDGYPRTLQQLDFLEGFLKRRALTLD
FT                   AVFSLEVATDLLIERLRARSKESGRTDDRDSVIARRLEIYTEMTLPIIDACEEKGLLHR
FT                   IDASKGIEEVFQSIKDVFDRVTI"
     MRAIMVGPPG SGKGTQCGLI QSRLGISVIA TGDVFRERMK TDMALRDIVS SGGYVSDSTT        60
     NRIVEDCLDK EDVSSGFVLD GYPRTLQQLD FLEGFLKRRA LTLDAVFSLE VATDLLIERL       120
     RARSKESGRT DDRDSVIARR LEIYTEMTLP IIDACEEKGL LHRIDASKGI EEVFQSIKDV       180
     FDRVTI                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page