(data stored in ACNUC30630 zone)

EMBL: BX251410.ALR1

BX251410.ALR1        Location/Qualifiers
FT   CDS             complement(299448..300608)
FT                   /transl_table=11
FT                   /gene="alr1"
FT                   /locus_tag="TW266"
FT                   /product="alanine racemase I"
FT                   /EC_number="5.1.1.1"
FT                   /note="Provides the d-alanine required for cell wall
FT                   biosynthesis. Similar to Streptomyces coelicolor alanine
FT                   racemase Alr or SCO4745 or SC6G4.23 SWALL:ALR_STRCO
FT                   (SWALL:O86786) (391 aa) fasta scores: E(): 1.2e-19, 29.5%
FT                   id in 400 aa, and to Lactobacillus plantarum alanine
FT                   racemase Alr SWALL:ALR_LACPL (SWALL:O08445) (375 aa) fasta
FT                   scores: E(): 0.0001, 24.13% id in 377 aa"
FT                   /protein_id="CAD66942.1"
FT                   /translation="MTQRTALSNSHAQAFISLGTLKKNLLWLQNEVAPAKVFMVIKANA
FT                   NGHGTMRVAEVAKMSGIRNFAVLLPKEALLIKRALSPGVRVFTWHITPDCEDLPSLIEN
FT                   NIEIGIGAEWQLRYIASCVKKTMTCEVLSGYKPALIHLKLDTGLSRGGCGVKDWQNLVC
FT                   LAQDFQEMGLIKITGFWSHLSNTSPEEDRRSLKIFTENVTPYLASYSRRARPIMHIAAS
FT                   VAALGLPESRLDYVRLGLSCFGYYEKEELKGVMTLVAPIIKFLPEQGRAIIACGFADGI
FT                   SPLAVRNNVPLTGRSNRARLIEVGPETSVIEICQDIDRRQDNLQNSYDHVPQDPFLNAL
FT                   RVSQNHVILFGSGGLSELTARQWAESCGTTIDDVLSRVKAELIYLE"
     MTQRTALSNS HAQAFISLGT LKKNLLWLQN EVAPAKVFMV IKANANGHGT MRVAEVAKMS        60
     GIRNFAVLLP KEALLIKRAL SPGVRVFTWH ITPDCEDLPS LIENNIEIGI GAEWQLRYIA       120
     SCVKKTMTCE VLSGYKPALI HLKLDTGLSR GGCGVKDWQN LVCLAQDFQE MGLIKITGFW       180
     SHLSNTSPEE DRRSLKIFTE NVTPYLASYS RRARPIMHIA ASVAALGLPE SRLDYVRLGL       240
     SCFGYYEKEE LKGVMTLVAP IIKFLPEQGR AIIACGFADG ISPLAVRNNV PLTGRSNRAR       300
     LIEVGPETSV IEICQDIDRR QDNLQNSYDH VPQDPFLNAL RVSQNHVILF GSGGLSELTA       360
     RQWAESCGTT IDDVLSRVKA ELIYLE                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page