(data stored in ACNUC30630 zone)

EMBL: BX251410.ALR2

BX251410.ALR2        Location/Qualifiers
FT   CDS             complement(300658..301320)
FT                   /transl_table=11
FT                   /gene="alr2"
FT                   /locus_tag="TW267"
FT                   /product="alanine racemase II"
FT                   /EC_number="5.1.1.1"
FT                   /note="Provides the d-alanine required for cell wall
FT                   biosynthesis. Similar to the C-terminal region of alanine
FT                   racemases eg. Corynebacterium glutamicum alanine racemase
FT                   Alr or cgl0588 SWALL:BAB97981 (EMBL:AY077456) (361 aa)
FT                   fasta scores: E(): 1.8e-07, 34.82% id in 112 aa."
FT                   /protein_id="CAD66943.1"
FT                   /translation="MISRLATITLESIKNNALLCLEADGDITVDLRADAFGHGLVKIAY
FT                   TLYSTGVRKCFVRKAHEKIFLEEIGFTVDVSDAPIKPFSHDIYGLGDNTECKAALHLES
FT                   CVVTCKKLPAGAGVSYCHTYRTQSEENVALIGIGYADGLPFQAQGSVEIKKRKYPIIGR
FT                   IAMDYMVAKVTPDSYKHGTRVTVWGESGAKTWGLSAGIDPLCLTAGLAYRVEKRWLT"
     MISRLATITL ESIKNNALLC LEADGDITVD LRADAFGHGL VKIAYTLYST GVRKCFVRKA        60
     HEKIFLEEIG FTVDVSDAPI KPFSHDIYGL GDNTECKAAL HLESCVVTCK KLPAGAGVSY       120
     CHTYRTQSEE NVALIGIGYA DGLPFQAQGS VEIKKRKYPI IGRIAMDYMV AKVTPDSYKH       180
     GTRVTVWGES GAKTWGLSAG IDPLCLTAGL AYRVEKRWLT                             220
//

If you have problems or comments...

PBIL Back to PBIL home page