(data stored in ACNUC30630 zone)

EMBL: BX251410.AROA

BX251410.AROA        Location/Qualifiers
FT   CDS             complement(231435..232766)
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="TW194"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Similar to Mycobacterium tuberculosis
FT                   3-phosphoshikimate 1-carboxyvinyltransferase AroA or Rv3227
FT                   or mt3324 or mtcy20b11.02 SWALL:AROA_MYCTU (SWALL:P22487)
FT                   (450 aa) fasta scores: E(): 1.6e-52, 42.4% id in 441 aa"
FT                   /db_xref="GOA:Q83I86"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I86"
FT                   /protein_id="CAD66871.1"
FT                   /translation="MAKTEMYQPPLGNRALFKMSIPGSKSLTNRHLIIAAIASGETTIH
FT                   NLLESRDTNLMIEGLRRIGCKIEKLNHTGTHDTGVISPHCTCLNDLIQPSDVRIIPSKH
FT                   YTCSTKIDCGLAGTVMRFLPVLAGLCKGSVEFFGDDQAIRRPMDGTLHALRKLGVQVDG
FT                   DRIPFTVHGRGEIEGGALETTEHSSSQFISGLLLSACRFKNGLTLKHIGNPLPSRPYID
FT                   MTVEVMREWGINVTHSDGVWAVTPKELTGKHITIEPDLSNAAPFMIGAIVTGGSATIQN
FT                   WPSKTSQPGKYLEAILPQFGAEITKTANTITVSGTGNITGIRADLGHIGELVPNLVALA
FT                   TLAETPSVFYNIGHIRYHETDRIEALVNEISSLGGTITAGKDYIKITPTTLTRSGVWKT
FT                   YKDHRMATSGAIIGLRHKLTIEDIECTSKTFPRFADLWSGAFGK"
     MAKTEMYQPP LGNRALFKMS IPGSKSLTNR HLIIAAIASG ETTIHNLLES RDTNLMIEGL        60
     RRIGCKIEKL NHTGTHDTGV ISPHCTCLND LIQPSDVRII PSKHYTCSTK IDCGLAGTVM       120
     RFLPVLAGLC KGSVEFFGDD QAIRRPMDGT LHALRKLGVQ VDGDRIPFTV HGRGEIEGGA       180
     LETTEHSSSQ FISGLLLSAC RFKNGLTLKH IGNPLPSRPY IDMTVEVMRE WGINVTHSDG       240
     VWAVTPKELT GKHITIEPDL SNAAPFMIGA IVTGGSATIQ NWPSKTSQPG KYLEAILPQF       300
     GAEITKTANT ITVSGTGNIT GIRADLGHIG ELVPNLVALA TLAETPSVFY NIGHIRYHET       360
     DRIEALVNEI SSLGGTITAG KDYIKITPTT LTRSGVWKTY KDHRMATSGA IIGLRHKLTI       420
     EDIECTSKTF PRFADLWSGA FGK                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page