(data stored in ACNUC30630 zone)

EMBL: BX251410.CLPP1

BX251410.CLPP1       Location/Qualifiers
FT   CDS             318864..319406
FT                   /transl_table=11
FT                   /gene="clpP1"
FT                   /locus_tag="TW283"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 1"
FT                   /EC_number="3.4.21.92"
FT                   /note="Similar to Streptomyces coelicolor ATP-dependent Clp
FT                   protease proteolytic subunit 1 ClpP1 or SCO2619 or
FT                   SCC80.04c SWALL:CLP1_STRCO (SWALL:Q9F315) (219 aa) fasta
FT                   scores: E(): 5.1e-39, 58.82% id in 170 aa"
FT                   /db_xref="GOA:Q83I19"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I19"
FT                   /protein_id="CAD66957.1"
FT                   /translation="MSETKQTVFDRLLQERIVWLGEAIDDKLANEICAKILLLNADDPK
FT                   EDIFLYINSPGGSITAGMAIYDTMQFVSNDIVTVGIGMAASMGQVLLTSGTQNKRYIMP
FT                   NARVLLHQPLAGFGGTASDIQTQAKLILDMKYRLSQITASRTGKTVEQIMEDGDRDHWF
FT                   TAEEALEYGFVDHIRTE"
     MSETKQTVFD RLLQERIVWL GEAIDDKLAN EICAKILLLN ADDPKEDIFL YINSPGGSIT        60
     AGMAIYDTMQ FVSNDIVTVG IGMAASMGQV LLTSGTQNKR YIMPNARVLL HQPLAGFGGT       120
     ASDIQTQAKL ILDMKYRLSQ ITASRTGKTV EQIMEDGDRD HWFTAEEALE YGFVDHIRTE       180
//

If you have problems or comments...

PBIL Back to PBIL home page