(data stored in ACNUC30630 zone)

EMBL: BX251410.CLPP2

BX251410.CLPP2       Location/Qualifiers
FT   CDS             319418..320041
FT                   /transl_table=11
FT                   /gene="clpP2"
FT                   /locus_tag="TW284"
FT                   /product="ATP dependent Clp protease proteolytic subunit 2"
FT                   /EC_number="3.4.21.92"
FT                   /note="Similar to Streptomyces coelicolor ATP-dependent Clp
FT                   protease proteolytic subunit 2 ClpP2 or SCO2618 or
FT                   SCC80.03c SWALL:CLP2_STRCO (SWALL:Q9ZH58) (218 aa) fasta
FT                   scores: E(): 3e-48, 67% id in 197 aa"
FT                   /db_xref="GOA:Q83I18"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I18"
FT                   /protein_id="CAD66958.1"
FT                   /translation="MYPNSRYILPSLDERTAYGYKQVDPYTKLFEDRIVFLGVQIDDAS
FT                   ADDVMAQLLVLEGQDAERDIIMYINSPGGSFTAMTAIYDTMQYIRPQIQTVCLGQAASA
FT                   AAVILSAGTPGKRLALPNARILIHQPVVASSGYGQASDIEIQAREIMRMREWLEKTLAQ
FT                   HSNKSVKQVSKDIDRDKILSSEQALEYGLIDQILVSRKAGLGKK"
     MYPNSRYILP SLDERTAYGY KQVDPYTKLF EDRIVFLGVQ IDDASADDVM AQLLVLEGQD        60
     AERDIIMYIN SPGGSFTAMT AIYDTMQYIR PQIQTVCLGQ AASAAAVILS AGTPGKRLAL       120
     PNARILIHQP VVASSGYGQA SDIEIQAREI MRMREWLEKT LAQHSNKSVK QVSKDIDRDK       180
     ILSSEQALEY GLIDQILVSR KAGLGKK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page