(data stored in ACNUC30630 zone)

EMBL: BX251410.COAA

BX251410.COAA        Location/Qualifiers
FT   CDS             complement(180517..181272)
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="TW156"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="Similar to Escherichia coli pantothenate kinase CoaA
FT                   or Rts or PanK or b3974 or z5545 or ecs4901
FT                   SWALL:COAA_ECOLI (SWALL:P15044) (316 aa) fasta scores: E():
FT                   4.5e-12, 39.66% id in 242 aa"
FT                   /protein_id="CAD66836.1"
FT                   /translation="MGIEVFKKDITKTYTEMLKDIRKRVRERGKVGKSFIIGITGSVAA
FT                   GKSTLASDLAKMLDGISVEVISTDGYLYPNKILEQKGLMLKKGFPESYDTAHLASLVKN
FT                   IKAGAKTIGIRQYAHPIHDVTGVIKTVNKPEILIIEGLNVMRHPVKTVVDLGIYIEAPK
FT                   RSVFKWYVKRFFELRAQHEKNTYFRKYANLPRRQCIKMLKQVWRDVNRKNFTENILPVK
FT                   HTADFIVYKNPRHKMTLYRNEASSSGFPV"
     MGIEVFKKDI TKTYTEMLKD IRKRVRERGK VGKSFIIGIT GSVAAGKSTL ASDLAKMLDG        60
     ISVEVISTDG YLYPNKILEQ KGLMLKKGFP ESYDTAHLAS LVKNIKAGAK TIGIRQYAHP       120
     IHDVTGVIKT VNKPEILIIE GLNVMRHPVK TVVDLGIYIE APKRSVFKWY VKRFFELRAQ       180
     HEKNTYFRKY ANLPRRQCIK MLKQVWRDVN RKNFTENILP VKHTADFIVY KNPRHKMTLY       240
     RNEASSSGFP V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page