(data stored in ACNUC30630 zone)

EMBL: BX251410.COAD

BX251410.COAD        Location/Qualifiers
FT   CDS             234982..235512
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="TW196"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to Escherichia coli phosphopantetheine
FT                   adenylyltransferase CoaD or KdtB or b3634 or z5058 or
FT                   ecs4509 SWALL:COAD_ECOLI (SWALL:P23875) (159 aa) fasta
FT                   scores: E(): 3.8e-06, 33.13% id in 169 aa"
FT                   /db_xref="GOA:Q83I84"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I84"
FT                   /protein_id="CAD66873.1"
FT                   /translation="MSNRIAVVPGTFDPVTRGHMDILTRTSRIFNTLYVLVANNPDKTP
FT                   LLPMHDRVDLVGQALEEYGFPRSEPKCDSESDRNGPIVKIHRFEKGLLVDCCKQLGATV
FT                   IVRGLISADAHREASMAYANRNMSGIETVFILPDPPLSVVSSSMVRQLIALGGDISPYV
FT                   PACVTRFFGTHSG"
     MSNRIAVVPG TFDPVTRGHM DILTRTSRIF NTLYVLVANN PDKTPLLPMH DRVDLVGQAL        60
     EEYGFPRSEP KCDSESDRNG PIVKIHRFEK GLLVDCCKQL GATVIVRGLI SADAHREASM       120
     AYANRNMSGI ETVFILPDPP LSVVSSSMVR QLIALGGDIS PYVPACVTRF FGTHSG           176
//

If you have problems or comments...

PBIL Back to PBIL home page