(data stored in ACNUC30630 zone)

EMBL: BX251410.DDLA

BX251410.DDLA        Location/Qualifiers
FT   CDS             286979..288022
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="TW257"
FT                   /product="D-alanine--D-alanine ligase A"
FT                   /EC_number="6.3.2.4"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 D-alanine--D-alanine ligase A DdlA or b0381 or
FT                   z0477 or ecs0431 SWALL:DDLA_ECOLI (SWALL:P23844) (364 aa)
FT                   fasta scores: E(): 5.1e-32, 32.86% id in 353 aa"
FT                   /db_xref="GOA:Q83I36"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I36"
FT                   /protein_id="CAD66933.1"
FT                   /translation="MRSLLLLFGGRSQEHSVSYASARALLEHICDEWTVIPVGITKHGD
FT                   FVYCSTVSEQDYGEVIDNGNRVVWPSRAGCKKIEVVQARGKSFFVEFDLVFPLLHGVFG
FT                   EDGTIQGMLDLLDIPYVGSGVFASAAAMDKHYTKILCSHAGIPVLPWYLIKGHAWHKNR
FT                   DSFLKQISDRFTFPLFVKPVDAGSSFGCTFVDFFEQLPVAIEHALQHGKSAIVEPALDA
FT                   PEVFCSLIENNGVLQCSELVFVKHSGSKFYDYSAKYLNPVEFVIPAQFDNTDGYAEIAS
FT                   KVFFELGCRHYARIDFFVTESGLVLNEINTSPGLTQKSIFPSSFKSMQYSQVIETILAS
FT                   AYCQVKR"
     MRSLLLLFGG RSQEHSVSYA SARALLEHIC DEWTVIPVGI TKHGDFVYCS TVSEQDYGEV        60
     IDNGNRVVWP SRAGCKKIEV VQARGKSFFV EFDLVFPLLH GVFGEDGTIQ GMLDLLDIPY       120
     VGSGVFASAA AMDKHYTKIL CSHAGIPVLP WYLIKGHAWH KNRDSFLKQI SDRFTFPLFV       180
     KPVDAGSSFG CTFVDFFEQL PVAIEHALQH GKSAIVEPAL DAPEVFCSLI ENNGVLQCSE       240
     LVFVKHSGSK FYDYSAKYLN PVEFVIPAQF DNTDGYAEIA SKVFFELGCR HYARIDFFVT       300
     ESGLVLNEIN TSPGLTQKSI FPSSFKSMQY SQVIETILAS AYCQVKR                     347
//

If you have problems or comments...

PBIL Back to PBIL home page