(data stored in ACNUC30630 zone)

EMBL: BX251410.DNAA

BX251410.DNAA        Location/Qualifiers
FT   CDS             1..1437
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="TW001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Similar to Streptomyces coelicolor chromosomal
FT                   replication initiator protein DnaA or SCO3879 or SCH18.16c
FT                   SWALL:DNAA_STRCO (SWALL:P27902) (656 aa) fasta scores: E():
FT                   3.8e-67, 53.02% id in 347 aa, and to Micrococcus luteus
FT                   chromosomal replication initiator protein DnaA
FT                   SWALL:DNAA_MICLU (SWALL:P21173) (515 aa) fasta scores: E():
FT                   1.1e-64, 42.17% id in 505 aa"
FT                   /db_xref="GOA:Q83NZ5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NZ5"
FT                   /protein_id="CAD66693.1"
FT                   /translation="MNKTLNPQEVWIKAVRNLEGFFSSPRVIGYLKKASPSIEGESLII
FT                   TFPNSHLASVMDDIEVYDATKKTILDSYPSIKEIKITISPDVLEKEITEEINDLVQSME
FT                   EEDFALIDHTKPVIPNFFDQNTRVNFGGGPNNHHPTTGVNPRFTFDNFVVGKSNELARA
FT                   ASISAAERPGKSFNPLFIYGDSGVGKTHLLHSIGNYAKFLFPSLRIKYVSSEDFTNDFI
FT                   NSISSGTSQKFQEKYRQIDILMVDDIQFLQKKQETQESFFHTFNSLHNSSRQLVISSDL
FT                   PPKQLMGFEDRMRSRFECGLVCDIQKPDLETRIAILQKKCQNEKKEVSMEILTYIASCF
FT                   SSSVRELEGALLRIFALASFNKEEINMTLAQKVLEDLGAQRGDKIDPIEIIEITAKHYD
FT                   LAASDLCGNSRVANISIARQIAMYLCRELTDVSLPKLGYIFGRDHSTIIYATRRISDLI
FT                   GKDRKTFSDIYKLTQFILRR"
     MNKTLNPQEV WIKAVRNLEG FFSSPRVIGY LKKASPSIEG ESLIITFPNS HLASVMDDIE        60
     VYDATKKTIL DSYPSIKEIK ITISPDVLEK EITEEINDLV QSMEEEDFAL IDHTKPVIPN       120
     FFDQNTRVNF GGGPNNHHPT TGVNPRFTFD NFVVGKSNEL ARAASISAAE RPGKSFNPLF       180
     IYGDSGVGKT HLLHSIGNYA KFLFPSLRIK YVSSEDFTND FINSISSGTS QKFQEKYRQI       240
     DILMVDDIQF LQKKQETQES FFHTFNSLHN SSRQLVISSD LPPKQLMGFE DRMRSRFECG       300
     LVCDIQKPDL ETRIAILQKK CQNEKKEVSM EILTYIASCF SSSVRELEGA LLRIFALASF       360
     NKEEINMTLA QKVLEDLGAQ RGDKIDPIEI IEITAKHYDL AASDLCGNSR VANISIARQI       420
     AMYLCRELTD VSLPKLGYIF GRDHSTIIYA TRRISDLIGK DRKTFSDIYK LTQFILRR         478
//

If you have problems or comments...

PBIL Back to PBIL home page