(data stored in ACNUC30630 zone)

EMBL: BX251410.DNAN

BX251410.DNAN        Location/Qualifiers
FT   CDS             1767..2900
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="TW002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Streptomyces coelicolor DNA polymerase
FT                   III, beta chain DnaN or SCO3878 or SCH18.15c
FT                   SWALL:DP3B_STRCO (SWALL:P27903) (376 aa) fasta scores: E():
FT                   7.5e-42, 35.46% id in 375 aa"
FT                   /protein_id="CAD66694.1"
FT                   /translation="MKLIVDRGLLSSSVNFVTRMIPARPPSPILSGMLIEAKNEKVTLS
FT                   TFNYETSAKVEFSANVIEGGKVLVPGTLISSISQKLPDEPVEISKEDEKISLTCGPVNY
FT                   ILNLMPIAEYPPLPNLENAEQYRIPSEDFVKSVSQVTTSAAKDDISAVITGINLRLSNE
FT                   SIELTGTDRYRVAVKTLNSVSGHPSDSSVIVSSKTLFEVSKTLGNLESEISVFIKNDGE
FT                   NKVIGFESGNKTVTSLLISGNYPPVAKLFTEETGHYAILKTSDFLESTKRVSVVVERDE
FT                   PIEFSFVKNTVTIKGSGIALASEKVECELFGDEISIMLRPQFLCDGLIACQEDFIKVAF
FT                   TKPSVKNRPGPVLITPKLSNKEKIDFKYLLQPNLFAK"
     MKLIVDRGLL SSSVNFVTRM IPARPPSPIL SGMLIEAKNE KVTLSTFNYE TSAKVEFSAN        60
     VIEGGKVLVP GTLISSISQK LPDEPVEISK EDEKISLTCG PVNYILNLMP IAEYPPLPNL       120
     ENAEQYRIPS EDFVKSVSQV TTSAAKDDIS AVITGINLRL SNESIELTGT DRYRVAVKTL       180
     NSVSGHPSDS SVIVSSKTLF EVSKTLGNLE SEISVFIKND GENKVIGFES GNKTVTSLLI       240
     SGNYPPVAKL FTEETGHYAI LKTSDFLEST KRVSVVVERD EPIEFSFVKN TVTIKGSGIA       300
     LASEKVECEL FGDEISIMLR PQFLCDGLIA CQEDFIKVAF TKPSVKNRPG PVLITPKLSN       360
     KEKIDFKYLL QPNLFAK                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page