(data stored in ACNUC30630 zone)

EMBL: BX251410.DUT

BX251410.DUT         Location/Qualifiers
FT   CDS             312051..312491
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="TW277"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to Streptomyces coelicolor deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut or SCO5868 or
FT                   SC2E9.09 SWALL:DUT_STRCO (SWALL:O54134) (183 aa) fasta
FT                   scores: E(): 5.6e-21, 50% id in 130 aa"
FT                   /db_xref="GOA:Q83I22"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I22"
FT                   /protein_id="CAD66951.1"
FT                   /translation="MTVEVLFKGGYTPQRAFDGDAGFDLQSSHTAVIQPRCRQVVKTGI
FT                   AIALPDGYAGFIMPRSGLASENGITLVNSPGVIDAGYRGEISVVLINTDLHQAFHISQG
FT                   DRIAQLVIMPVCHASFIEVDTLPGSARGISAFGSSGRHDTRG"
     MTVEVLFKGG YTPQRAFDGD AGFDLQSSHT AVIQPRCRQV VKTGIAIALP DGYAGFIMPR        60
     SGLASENGIT LVNSPGVIDA GYRGEISVVL INTDLHQAFH ISQGDRIAQL VIMPVCHASF       120
     IEVDTLPGSA RGISAFGSSG RHDTRG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page