(data stored in ACNUC30630 zone)

EMBL: BX251410.DXR

BX251410.DXR         Location/Qualifiers
FT   CDS             complement(98907..100013)
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="TW099"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="Similar to Pseudomonas aeruginosa 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase Dxr or pa3650 SWALL:DXR_PSEAE
FT                   (SWALL:Q9KGU6) (396 aa) fasta scores: E(): 6.2e-42, 40.92%
FT                   id in 391 aa"
FT                   /db_xref="GOA:Q83IC8"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC8"
FT                   /protein_id="CAD66783.1"
FT                   /translation="MQRVIIVGSTGSIGTQAIDFILKNRDSFLVVGLAASTQTSLLREQ
FT                   AQVFGTKNTAQGASEAAELIEATEADVVLNAITGAAGLLSTYATLKTGKRLALANKESL
FT                   IMGGKYFLDMTSFKGQITPVDSEHSAIAQAMKSGKFSEVNKLILTASGGPFYDRESLEG
FT                   ITLKDALDHPTWNMGPMISINSATMFNKGLEIIEAHLLFGIPYSQIDVVIHPQSIVHSM
FT                   VEYKDGSVIAQASVADMTLPIGYALSWPNRALNAVRPLEWGARQRWDFLPPTENSMRSI
FT                   NLARRAGEAGGVYPAVLNASNECAVEAFMAGKISFARIIHVTETVFNLYTKQHTNRESA
FT                   KNPIEVILEEDARTRELAKTVIENMSAD"
     MQRVIIVGST GSIGTQAIDF ILKNRDSFLV VGLAASTQTS LLREQAQVFG TKNTAQGASE        60
     AAELIEATEA DVVLNAITGA AGLLSTYATL KTGKRLALAN KESLIMGGKY FLDMTSFKGQ       120
     ITPVDSEHSA IAQAMKSGKF SEVNKLILTA SGGPFYDRES LEGITLKDAL DHPTWNMGPM       180
     ISINSATMFN KGLEIIEAHL LFGIPYSQID VVIHPQSIVH SMVEYKDGSV IAQASVADMT       240
     LPIGYALSWP NRALNAVRPL EWGARQRWDF LPPTENSMRS INLARRAGEA GGVYPAVLNA       300
     SNECAVEAFM AGKISFARII HVTETVFNLY TKQHTNRESA KNPIEVILEE DARTRELAKT       360
     VIENMSAD                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page