(data stored in ACNUC30630 zone)

EMBL: BX251410.DXS

BX251410.DXS         Location/Qualifiers
FT   CDS             313747..315636
FT                   /transl_table=11
FT                   /gene="Dxs"
FT                   /locus_tag="TW280"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase"
FT                   /EC_number="4.1.3.37"
FT                   /note="Similar to Streptomyces sp. 1-deoxy-D-xylulose
FT                   5-phosphate synthase Dxs SWALL:DXS_STRC1 (SWALL:Q9RBN6)
FT                   (631 aa) fasta scores: E(): 3.4e-117, 49.75% id in 621 aa"
FT                   /db_xref="GOA:Q83I20"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I20"
FT                   /protein_id="CAD66954.1"
FT                   /translation="MCTKRQYGLLESIRSPRDLDSFTPHQLDELECQVRDFLIQSVAKT
FT                   GGHLGSNLGVVELSIALHRSFRSPEDCIIFDVGHQCYVHKLITGRHDFKALRCKNGLSG
FT                   YPSRHESNHDIVENSHASAALSWADGVSRARTLLGNDNYVIAVVGDGSLTGGMCWEALN
FT                   NISDDNNRRLVIVVNDNGRSYARTIGGIARFLNAVRASKSYLWLRESSEAVFSHMGSPG
FT                   RRLYQGIRGAIHGFLSRFSSSNKLFSNLDIRYLGPINGHNRKALEKAFKQAKQYARPII
FT                   VHVITEKGHGYPPALEDALDCLHTVGVIDPSTGKSASVQGQVRQDTWTGVFGEELLRLA
FT                   ESNTNIVAVTAAMLHPTGLSMFAEKFPHRVFDVGIAEQHAVASAAGLAYEGLHPVVAIY
FT                   STFMNRAFDQVMMDVALHGAPVTFVLDRAGITGPDGASHHGIWDLSLLRIVPGIKLYAP
FT                   RDASTLRNTLALVCSEDCPTAIRFPRGSVCDDLPALRSLDDGIDVLYGSCDREDIVIVA
FT                   IGVMAHACVRAAQLLAESGIESTVINPVCFWPLHRQVLARVSKAKLVVLAEEGAKSPGL
FT                   GDYIAGRRLLEFVIPGDFQPQGSRDELLDAIGLNGEHIARKIKARFNQIINCV"
     MCTKRQYGLL ESIRSPRDLD SFTPHQLDEL ECQVRDFLIQ SVAKTGGHLG SNLGVVELSI        60
     ALHRSFRSPE DCIIFDVGHQ CYVHKLITGR HDFKALRCKN GLSGYPSRHE SNHDIVENSH       120
     ASAALSWADG VSRARTLLGN DNYVIAVVGD GSLTGGMCWE ALNNISDDNN RRLVIVVNDN       180
     GRSYARTIGG IARFLNAVRA SKSYLWLRES SEAVFSHMGS PGRRLYQGIR GAIHGFLSRF       240
     SSSNKLFSNL DIRYLGPING HNRKALEKAF KQAKQYARPI IVHVITEKGH GYPPALEDAL       300
     DCLHTVGVID PSTGKSASVQ GQVRQDTWTG VFGEELLRLA ESNTNIVAVT AAMLHPTGLS       360
     MFAEKFPHRV FDVGIAEQHA VASAAGLAYE GLHPVVAIYS TFMNRAFDQV MMDVALHGAP       420
     VTFVLDRAGI TGPDGASHHG IWDLSLLRIV PGIKLYAPRD ASTLRNTLAL VCSEDCPTAI       480
     RFPRGSVCDD LPALRSLDDG IDVLYGSCDR EDIVIVAIGV MAHACVRAAQ LLAESGIEST       540
     VINPVCFWPL HRQVLARVSK AKLVVLAEEG AKSPGLGDYI AGRRLLEFVI PGDFQPQGSR       600
     DELLDAIGLN GEHIARKIKA RFNQIINCV                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page