(data stored in ACNUC30630 zone)

EMBL: BX251410.FOLE

BX251410.FOLE        Location/Qualifiers
FT   CDS             216002..216547
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /gene_synonym="mtrA"
FT                   /locus_tag="TW174"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="Similar to Bacillus subtilis GTP cyclohydrolase I
FT                   FolE or MtrA SWALL:GCH1_BACSU (SWALL:P19465) (190 aa) fasta
FT                   scores: E(): 1.9e-12, 33.53% id in 167 aa, and to Bacillus
FT                   halodurans GTP cyclohydrolase I FolE or MtrA or bh1646
FT                   SWALL:GCH1_BACHD (SWALL:Q9KCC7) (188 aa) fasta scores: E():
FT                   2.6e-14, 32.25% id in 186 aa"
FT                   /protein_id="CAD66853.1"
FT                   /translation="MTKLCRFESGSAQSAVANLLSALGQDVGRLKETPSIASSGLESLI
FT                   SGSETNPADCLVDLIPNTQKGIVILRDIPFRSICEHHLLPFVGTANLLYEPGKFLAGLG
FT                   NLTSLVRCAARRLSIQERVTDQIADAIYTGLCARRVLVSLAARHTCILDEAGNTEVTTF
FT                   AHRGIGDADIISFMTIIR"
     MTKLCRFESG SAQSAVANLL SALGQDVGRL KETPSIASSG LESLISGSET NPADCLVDLI        60
     PNTQKGIVIL RDIPFRSICE HHLLPFVGTA NLLYEPGKFL AGLGNLTSLV RCAARRLSIQ       120
     ERVTDQIADA IYTGLCARRV LVSLAARHTC ILDEAGNTEV TTFAHRGIGD ADIISFMTII       180
     R                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page