(data stored in ACNUC30630 zone)

EMBL: BX251410.FTSZ

BX251410.FTSZ        Location/Qualifiers
FT   CDS             275690..276775
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="TW247"
FT                   /product="cell division protein FtsZ"
FT                   /note="Similar to Streptomyces coelicolor cell division
FT                   protein FtsZ or SCO2082 or SC4A10.15c SWALL:FTSZ_STRCO
FT                   (SWALL:P45500) (399 aa) fasta scores: E(): 4.9e-88, 77.28%
FT                   id in 339 aa"
FT                   /protein_id="CAD66923.1"
FT                   /translation="MRDVVGSQNYLAVIKVVGIGGGGVNAVNRMIELGLRGVEFVAVNT
FT                   DAQALLMSDADVKLDVGRASTRGLGAGADPEVGRRSAEEHAGEIEETLTGADMVFITAG
FT                   EGGGTGTGGAPVVAKIAKSVGALTIGVVTKPFGFEGKRRALQAEQGIAALKNEVDTLIV
FT                   VPNDRLLEISDRNISMLDAFATADQVLLSGVQGITDLITTPGLINLDFADVRSVMQGAG
FT                   SALMGIGSARGADRAIKAAELAVASPLLEASIDGAHGVLLSIQGGSDLGIFEINDAAKL
FT                   VQEVVHPEANIIFGAVINDTLGDEVRVTVIAAGFDGGEPTLKPTSIAPLQQDKYPDALT
FT                   PSQSDDYPFEEDGLDVPDFLR"
     MRDVVGSQNY LAVIKVVGIG GGGVNAVNRM IELGLRGVEF VAVNTDAQAL LMSDADVKLD        60
     VGRASTRGLG AGADPEVGRR SAEEHAGEIE ETLTGADMVF ITAGEGGGTG TGGAPVVAKI       120
     AKSVGALTIG VVTKPFGFEG KRRALQAEQG IAALKNEVDT LIVVPNDRLL EISDRNISML       180
     DAFATADQVL LSGVQGITDL ITTPGLINLD FADVRSVMQG AGSALMGIGS ARGADRAIKA       240
     AELAVASPLL EASIDGAHGV LLSIQGGSDL GIFEINDAAK LVQEVVHPEA NIIFGAVIND       300
     TLGDEVRVTV IAAGFDGGEP TLKPTSIAPL QQDKYPDALT PSQSDDYPFE EDGLDVPDFL       360
     R                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page