(data stored in ACNUC30630 zone)

EMBL: BX251410.GCP

BX251410.GCP         Location/Qualifiers
FT   CDS             209856..211061
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="TW170"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Similar to Pasteurella haemolytica
FT                   O-sialoglycoprotein endopeptidase Gcp SWALL:GCP_PASHA
FT                   (SWALL:P36175) (325 aa) fasta scores: E(): 1.5e-13, 36.97%
FT                   id in 384 aa, and to Streptomyces coelicolor probable
FT                   O-sialoglycoprotein endopeptidase Gcp or SCO4752 or
FT                   SC6G4.30 SWALL:GCP_STRCO (SWALL:O86793) (374 aa) fasta
FT                   scores: E(): 4.3e-20, 43.71% id in 398 aa"
FT                   /db_xref="GOA:Q83I95"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I95"
FT                   /protein_id="CAD66849.1"
FT                   /translation="MSIILGIETSCDETGVGIVSGSTVLANEVASSSLRHKPFGGVIPE
FT                   IAARAHLEYLPNLLELALETAQLCIKDIDGIAVTAGPGLVTSLSVGVSAAKALGLSTGT
FT                   PVYGVNHLVGHAVSAFLDDYTNDGLGVIHRRDSIGSNGIENDASSTHSHTHTTQVNRHS
FT                   NLCVYTPPRRVLRDVCKYMHVRDSVVLLASGGHSCLLKIHNNKISLLGETLDDAAGEAF
FT                   DKIARLMGLQYPGGPAIEMLASSGNPNAVEFPRALLTHFEEHNRYSFSFSGLKTAVGRV
FT                   VERIKSNPAHSIPKIEDIAASFQEAVADVLTAKTVAAALASDVDLIVMGGGVAANNRIR
FT                   EMLCERAKIHGLDVKIPPIALCTDNGAMIAAAGSWLMQLGYNPSHSRFSPVSIMPLTQM
FT                   VV"
     MSIILGIETS CDETGVGIVS GSTVLANEVA SSSLRHKPFG GVIPEIAARA HLEYLPNLLE        60
     LALETAQLCI KDIDGIAVTA GPGLVTSLSV GVSAAKALGL STGTPVYGVN HLVGHAVSAF       120
     LDDYTNDGLG VIHRRDSIGS NGIENDASST HSHTHTTQVN RHSNLCVYTP PRRVLRDVCK       180
     YMHVRDSVVL LASGGHSCLL KIHNNKISLL GETLDDAAGE AFDKIARLMG LQYPGGPAIE       240
     MLASSGNPNA VEFPRALLTH FEEHNRYSFS FSGLKTAVGR VVERIKSNPA HSIPKIEDIA       300
     ASFQEAVADV LTAKTVAAAL ASDVDLIVMG GGVAANNRIR EMLCERAKIH GLDVKIPPIA       360
     LCTDNGAMIA AAGSWLMQLG YNPSHSRFSP VSIMPLTQMV V                           401
//

If you have problems or comments...

PBIL Back to PBIL home page