(data stored in ACNUC30630 zone)

EMBL: BX251410.GCVP

BX251410.GCVP        Location/Qualifiers
FT   CDS             155275..158181
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="TW144"
FT                   /product="glycine dehydrogenase [decarboxylating]"
FT                   /EC_number="1.4.4.2"
FT                   /note="Similar to Escherichia coli glycine dehydrogenase
FT                   [decarboxylating] GcvP or b2903 SWALL:GCSP_ECOLI
FT                   (SWALL:P33195) (956 aa) fasta scores: E(): 4.4e-106, 48.71%
FT                   id in 973 aa, and to Mycobacterium tuberculosis probable
FT                   glycine dehydrogenase [decarboxylating] GcvP or GcvB or
FT                   Rv1832 or mt1880 or mtcy1a11.11C SWALL:GCSP_MYCTU
FT                   (SWALL:Q50601) (941 aa) fasta scores: E(): 2e-114, 51.27%
FT                   id in 981 aa"
FT                   /db_xref="GOA:Q83IA7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA7"
FT                   /protein_id="CAD66824.1"
FT                   /translation="MHERHIGPSQEEIDHMLGFLGYKSLDDLMHAALPNGVQSPPDIKI
FT                   PSHDELTCLTQLAAFAKMNRIKTSMLGQGFYNCITPAVIRRNILENPSWYTSYTPYQPE
FT                   ISQGRLEMLINFQTMICDLTGLEIANASMLDEASCAAEAMLLAKRVSRSSSNKYLVHNG
FT                   VFPHIRRVLETRADAVGVEIVDLPEGQSIDFDHFGVYAQYQSASGKLLDLRPLFSRSKR
FT                   AGAICVIGCDLLMLTLFTSPGELGADIAFGSAQRFGIPMNFGGPLASFLAARKAMERSL
FT                   PGRLVGVSVDADSNHAYRLTLQTREQHIRREKATSNICTATVLMAIAAVAFAQHHGPKG
FT                   LRAIAHRINTVAVGFARLLKQTAFRVSSLDIFDTIEINNPTQVCVEAESKYDLLFWKVD
FT                   DNKLRITFDEVTARLDGDLPERLSKVFGISPDKIRDLGCNYDSCDCSFYGDLQQAREGL
FT                   SSVASRNISVHSDLARHPLRRFSGYLKHPVFNNYTGEVALMRYLKALSDKDFALDRGMI
FT                   PLGSCTMKLNAAFQLEPVLWPEFANLHPFAPLGDADGTLQIIDQIETWLANLSGYDAVS
FT                   LQPTAGSQGELAGLLAIRGYYKSLNLDRDVCLIPASAHGTNAASAVLAGMRVVVVACDQ
FT                   QGNIDLDDLRLKASKNAHALAALMVTYPSTHGVYEDNISEVCSVVHKYGGQVYVDGANS
FT                   NALIGYLRTGDFGGDVSHLNLHKTFGIPHGGGGPGIGPVVAKAHLAPFLPFRNRVHKPS
FT                   TDLPAVKHMGGPIASSDYGFAGALYISWAYIFCLGSQGMKRCTAVAVLVANYIAKQLSD
FT                   TFPVLYTGKNNLVAHEFIMDFREVTRVSGITVDDVCKRLIDYGFHAPTMSFPVPGTLMV
FT                   EPTESEPFSEIQRFIKTIRSIRAEIDRVIDKTYDPDNNPLKRAPHTLEQIASDKWDRPY
FT                   SRRTGIVYTSGKYWPASARIDNAYGDRNIFCTCPDLPD"
     MHERHIGPSQ EEIDHMLGFL GYKSLDDLMH AALPNGVQSP PDIKIPSHDE LTCLTQLAAF        60
     AKMNRIKTSM LGQGFYNCIT PAVIRRNILE NPSWYTSYTP YQPEISQGRL EMLINFQTMI       120
     CDLTGLEIAN ASMLDEASCA AEAMLLAKRV SRSSSNKYLV HNGVFPHIRR VLETRADAVG       180
     VEIVDLPEGQ SIDFDHFGVY AQYQSASGKL LDLRPLFSRS KRAGAICVIG CDLLMLTLFT       240
     SPGELGADIA FGSAQRFGIP MNFGGPLASF LAARKAMERS LPGRLVGVSV DADSNHAYRL       300
     TLQTREQHIR REKATSNICT ATVLMAIAAV AFAQHHGPKG LRAIAHRINT VAVGFARLLK       360
     QTAFRVSSLD IFDTIEINNP TQVCVEAESK YDLLFWKVDD NKLRITFDEV TARLDGDLPE       420
     RLSKVFGISP DKIRDLGCNY DSCDCSFYGD LQQAREGLSS VASRNISVHS DLARHPLRRF       480
     SGYLKHPVFN NYTGEVALMR YLKALSDKDF ALDRGMIPLG SCTMKLNAAF QLEPVLWPEF       540
     ANLHPFAPLG DADGTLQIID QIETWLANLS GYDAVSLQPT AGSQGELAGL LAIRGYYKSL       600
     NLDRDVCLIP ASAHGTNAAS AVLAGMRVVV VACDQQGNID LDDLRLKASK NAHALAALMV       660
     TYPSTHGVYE DNISEVCSVV HKYGGQVYVD GANSNALIGY LRTGDFGGDV SHLNLHKTFG       720
     IPHGGGGPGI GPVVAKAHLA PFLPFRNRVH KPSTDLPAVK HMGGPIASSD YGFAGALYIS       780
     WAYIFCLGSQ GMKRCTAVAV LVANYIAKQL SDTFPVLYTG KNNLVAHEFI MDFREVTRVS       840
     GITVDDVCKR LIDYGFHAPT MSFPVPGTLM VEPTESEPFS EIQRFIKTIR SIRAEIDRVI       900
     DKTYDPDNNP LKRAPHTLEQ IASDKWDRPY SRRTGIVYTS GKYWPASARI DNAYGDRNIF       960
     CTCPDLPD                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page