(data stored in ACNUC30630 zone)

EMBL: BX251410.GLMS

BX251410.GLMS        Location/Qualifiers
FT   CDS             184178..186028
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="TW158"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing]"
FT                   /EC_number="2.6.1.16"
FT                   /note="Similar to Escherichia coli
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing] GlmS or b3729 SWALL:GLMS_ECOLI (SWALL:P17169)
FT                   (608 aa) fasta scores: E(): 9.8e-90, 42.23% id in 618 aa,
FT                   and to Streptomyces coelicolor
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing] GlmS or SCO4740 or SC6G4.18 SWALL:GLMS_STRCO
FT                   (SWALL:O86781) (614 aa) fasta scores: E(): 1.5e-125, 53.73%
FT                   id in 616 aa"
FT                   /db_xref="GOA:Q83IA1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA1"
FT                   /protein_id="CAD66838.1"
FT                   /translation="MCGIIGYSGPRPAAEVLLKGLERLEYRGYDSAGIAVVTDKAYIES
FT                   VKKSGKLNVLKTCLERRTTPIVGSTGIGHTRWATHGEPSDRNAHPHMDTEQSLAIVHNG
FT                   IIENSDVLKRELLASGKSFTSETDTEVVAHLLSDAFKKTQDLVQAFVEVTQRLEGAFAV
FT                   VAIHKDQPNTIVAAKNNSPLLLGFGQGENFLASDIAAFAEYTQRVANIDQERIVALSGD
FT                   SVYITDFAGHPVDYEVHTVSWHPASVDSSGWSSFMLKEIFEEPQAVENTLKGRTEDGTV
FT                   ILPECDHIRDDLLAIDRVVLVGCGTAAYAAMTASYSIEAWAGLPVSVELSHEFRYREPV
FT                   LNSKTLAVFISQSGETMDSLMAVRYARQAGVKTISVCNVMDSSIPKESHAVIYTKAGPE
FT                   VAVASTKSFVCQIVVLYLLALYLGQLRGFRSIFPRQKAVCELNRLPVKLKQVLEIYESV
FT                   RQLAHWMSDSRSILFLGRHAGYPIALEAALKLKELAYIHAEGFAAGELKHGPIALIEPG
FT                   QPVFVIVPSPVGSPILHAKVISNIREIKSRGARIIAIAAEGDSAVLPHADSVLRIPLTR
FT                   YSFEPLLSIVPLQIFALELAADKGFDVDRPRNLAKSVTVE"
     MCGIIGYSGP RPAAEVLLKG LERLEYRGYD SAGIAVVTDK AYIESVKKSG KLNVLKTCLE        60
     RRTTPIVGST GIGHTRWATH GEPSDRNAHP HMDTEQSLAI VHNGIIENSD VLKRELLASG       120
     KSFTSETDTE VVAHLLSDAF KKTQDLVQAF VEVTQRLEGA FAVVAIHKDQ PNTIVAAKNN       180
     SPLLLGFGQG ENFLASDIAA FAEYTQRVAN IDQERIVALS GDSVYITDFA GHPVDYEVHT       240
     VSWHPASVDS SGWSSFMLKE IFEEPQAVEN TLKGRTEDGT VILPECDHIR DDLLAIDRVV       300
     LVGCGTAAYA AMTASYSIEA WAGLPVSVEL SHEFRYREPV LNSKTLAVFI SQSGETMDSL       360
     MAVRYARQAG VKTISVCNVM DSSIPKESHA VIYTKAGPEV AVASTKSFVC QIVVLYLLAL       420
     YLGQLRGFRS IFPRQKAVCE LNRLPVKLKQ VLEIYESVRQ LAHWMSDSRS ILFLGRHAGY       480
     PIALEAALKL KELAYIHAEG FAAGELKHGP IALIEPGQPV FVIVPSPVGS PILHAKVISN       540
     IREIKSRGAR IIAIAAEGDS AVLPHADSVL RIPLTRYSFE PLLSIVPLQI FALELAADKG       600
     FDVDRPRNLA KSVTVE                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page