(data stored in ACNUC30630 zone)

EMBL: BX251410.GLYQS

BX251410.GLYQS       Location/Qualifiers
FT   CDS             complement(293012..296086)
FT                   /transl_table=11
FT                   /gene="glyQS"
FT                   /locus_tag="TW262"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Chlamydia pneumoniae glycyl-tRNA
FT                   synthetase GlyQS or GlyQ or cpn0946 or cp0913
FT                   SWALL:SYG_CHLPN (SWALL:Q9Z6W0) (1010 aa) fasta scores: E():
FT                   8.9e-78, 30.52% id in 1055 aa, and to Arabidopsis thaliana
FT                   aminoacyl-t-RNA synthetase precursor Edd1 SWALL:O23150
FT                   (EMBL:AJ003069) (1067 aa) fasta scores: E(): 1.1e-100,
FT                   39.47% id in 1021 aa"
FT                   /protein_id="CAD66938.1"
FT                   /translation="MQKHTPRMQDTILILQTYWAHRGCLVFQPMNTEVGAGTANPATLL
FT                   GVLGDKTWGVAYVEPCVRPDDSRYGINPSRLQCHTQFQVLLKPEPGNPQEMYLESLEAI
FT                   GIDLKKHDIRFVEDNWESPALGAWGLGWEIWLDGLEITQFTYFQQVGGVPLKTSAVEIT
FT                   YGIERIMMALQKVSHFKDIEYSKNISYGELFAQNEREMSAYYLEKANIERNKQLFEIYS
FT                   DEAKMLLRAGLPLPAYTFVLKCSHVFNILDARGAISTAERAKAFSLMRTLTKEISATWV
FT                   ESRSNGEVSDDTVHTKGIDIAIEKPPDMKDPVTKGPETVLFEIGTEEMPSTQEIITTVE
FT                   NTLREKLGRSQLKFEKYSVDATPRRIVIRIYKMHPRQSDSSVRIRGPKVEAAFDDDKKP
FT                   TDALTGFLKANGKSLDEIEIAVHKNRRHVFITKNIPGQSAAKLLEQIFAEIVLEIRSSR
FT                   NMRWNDPKLVFSRPIRWLVALYGQRQLNVRVSLLESGMHTRVLRNSKTPIVPVKAADNY
FT                   EEFLTRNGVILSRSKRREIIFESANLAAKSVSCEIDFSTQPIEEITDLVEAPSLVICRF
FT                   EKKYLELPEVVLNAIMKKQKYITLSEKCATCKRIQREKCDQKTISQHFITFANGLCDKE
FT                   TVRSGNEAVIRTRFEDALFFQEADSKLSPENLYKMLDGLVYEEKLGSYLQKSQRIQRIT
FT                   DELLALMKADKNLSNTARQSAAIAKFDLASQMVTEMPELSGFMAKIYAQRAGKPPEVAQ
FT                   ALEDMEAPRSAGKSLPVTQAGAILSIADRLDQLVAMTALGITSTGSSDLFGVRRTASGL
FT                   VDILRVLPQKYDLNPIDIRVAVGKVVDIMQGYIMEHRGISNVILDGVEDSIVDLILGRW
FT                   RHRISDSQSRTLSMDTASLQNIVYAAQKTVLSEADKTFSQLCQIRQKSQFLEIVQCLKR
FT                   IDRICKNFYFERNDAPLKSVHEQNLINTFEAIRQTNCTDLEGFYRAAKNLPEAVNNFFD
FT                   NTLVMTPEEEIRTARLGLLCAIRSYSWKYAAWDYI"
     MQKHTPRMQD TILILQTYWA HRGCLVFQPM NTEVGAGTAN PATLLGVLGD KTWGVAYVEP        60
     CVRPDDSRYG INPSRLQCHT QFQVLLKPEP GNPQEMYLES LEAIGIDLKK HDIRFVEDNW       120
     ESPALGAWGL GWEIWLDGLE ITQFTYFQQV GGVPLKTSAV EITYGIERIM MALQKVSHFK       180
     DIEYSKNISY GELFAQNERE MSAYYLEKAN IERNKQLFEI YSDEAKMLLR AGLPLPAYTF       240
     VLKCSHVFNI LDARGAISTA ERAKAFSLMR TLTKEISATW VESRSNGEVS DDTVHTKGID       300
     IAIEKPPDMK DPVTKGPETV LFEIGTEEMP STQEIITTVE NTLREKLGRS QLKFEKYSVD       360
     ATPRRIVIRI YKMHPRQSDS SVRIRGPKVE AAFDDDKKPT DALTGFLKAN GKSLDEIEIA       420
     VHKNRRHVFI TKNIPGQSAA KLLEQIFAEI VLEIRSSRNM RWNDPKLVFS RPIRWLVALY       480
     GQRQLNVRVS LLESGMHTRV LRNSKTPIVP VKAADNYEEF LTRNGVILSR SKRREIIFES       540
     ANLAAKSVSC EIDFSTQPIE EITDLVEAPS LVICRFEKKY LELPEVVLNA IMKKQKYITL       600
     SEKCATCKRI QREKCDQKTI SQHFITFANG LCDKETVRSG NEAVIRTRFE DALFFQEADS       660
     KLSPENLYKM LDGLVYEEKL GSYLQKSQRI QRITDELLAL MKADKNLSNT ARQSAAIAKF       720
     DLASQMVTEM PELSGFMAKI YAQRAGKPPE VAQALEDMEA PRSAGKSLPV TQAGAILSIA       780
     DRLDQLVAMT ALGITSTGSS DLFGVRRTAS GLVDILRVLP QKYDLNPIDI RVAVGKVVDI       840
     MQGYIMEHRG ISNVILDGVE DSIVDLILGR WRHRISDSQS RTLSMDTASL QNIVYAAQKT       900
     VLSEADKTFS QLCQIRQKSQ FLEIVQCLKR IDRICKNFYF ERNDAPLKSV HEQNLINTFE       960
     AIRQTNCTDL EGFYRAAKNL PEAVNNFFDN TLVMTPEEEI RTARLGLLCA IRSYSWKYAA      1020
     WDYI                                                                   1024
//

If you have problems or comments...

PBIL Back to PBIL home page