(data stored in ACNUC30630 zone)

EMBL: BX251410.GPSA

BX251410.GPSA        Location/Qualifiers
FT   CDS             286002..286979
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="TW256"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="Similar to Bacillus subtilis glycerol-3-phosphate
FT                   dehydrogenase GpsA or GlyC SWALL:GPDA_BACSU (SWALL:P46919)
FT                   (345 aa) fasta scores: E(): 1.2e-31, 36.94% id in 314 aa,
FT                   and to Streptomyces coelicolor glycerol-3-phosphate
FT                   dehydrogenase GpsA or SCO5559 or SC7A1.03 SWALL:GPDA_STRCO
FT                   (SWALL:Q9ZBS0) (336 aa) fasta scores: E(): 1.6e-39, 43.59%
FT                   id in 312 aa"
FT                   /db_xref="GOA:Q83I37"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I37"
FT                   /protein_id="CAD66932.1"
FT                   /translation="MKEGGLRNKVAVIGSGSWGTAIANLLCKAGNETILWGRDENVIDE
FT                   INNARVNSKYLPGVELFLRATCDLDYAVADASHVYIALPSFALSKVLPKLSLDKFSIVI
FT                   SLIKCLEPDTGRRMSEVISEALDLGHNRLAVISGPNLALEVANDEPSVSVVASANIATA
FT                   NIVAGTLKCPGFYCIPSSDIKGVEICAASKNLVALISGIARGMDLGDNTRAALITLGFR
FT                   ELLRLVLENGGTEETVFGVAGLGDVVATCNSHLSRNNKAGVLLAKGAPLDEVKQTAEGV
FT                   VAISGVLALAERSGVYMPIAQALSQVISGKRTAHSLLDICFSLA"
     MKEGGLRNKV AVIGSGSWGT AIANLLCKAG NETILWGRDE NVIDEINNAR VNSKYLPGVE        60
     LFLRATCDLD YAVADASHVY IALPSFALSK VLPKLSLDKF SIVISLIKCL EPDTGRRMSE       120
     VISEALDLGH NRLAVISGPN LALEVANDEP SVSVVASANI ATANIVAGTL KCPGFYCIPS       180
     SDIKGVEICA ASKNLVALIS GIARGMDLGD NTRAALITLG FRELLRLVLE NGGTEETVFG       240
     VAGLGDVVAT CNSHLSRNNK AGVLLAKGAP LDEVKQTAEG VVAISGVLAL AERSGVYMPI       300
     AQALSQVISG KRTAHSLLDI CFSLA                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page