(data stored in ACNUC30630 zone)

EMBL: BX251410.GROS

BX251410.GROS        Location/Qualifiers
FT   CDS             82958..83341
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="TW084"
FT                   /product="10 kDa chaperonin"
FT                   /note="Similar to Streptomyces coelicolor and Streptomyces
FT                   lividans 10 kDa chaperonin GroS or SCO4761 or SC6G4.39
FT                   SWALL:CH10_STRCO (SWALL:P40172) (102 aa) fasta scores: E():
FT                   3.9e-21, 68.42% id in 95 aa"
FT                   /protein_id="CAD66769.1"
FT                   /translation="MLRFGRILFSRGFLPSIDLEVLVHGRGSAVSFAIKPLGDRVVIRP
FT                   ADAEQVTASGLVIPDTAQERPQEGEVVAVGPGSLNDDGNRVPLDVSVGDRVIYARYGGT
FT                   EVKLGDDEYTILASRDVLAVVHR"
     MLRFGRILFS RGFLPSIDLE VLVHGRGSAV SFAIKPLGDR VVIRPADAEQ VTASGLVIPD        60
     TAQERPQEGE VVAVGPGSLN DDGNRVPLDV SVGDRVIYAR YGGTEVKLGD DEYTILASRD       120
     VLAVVHR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page