(data stored in ACNUC30630 zone)

EMBL: BX251410.GUAA

BX251410.GUAA        Location/Qualifiers
FT   CDS             87199..88710
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="TW089"
FT                   /product="GMP synthase [glutamine-hydrolyzing]"
FT                   /EC_number="6.3.5.2"
FT                   /note="Similar to Bacillus subtilis GMP synthase
FT                   [glutamine-hydrolyzing] GuaA SWALL:GUAA_BACSU
FT                   (SWALL:P29727) (513 aa) fasta scores: E(): 2.2e-94, 50.49%
FT                   id in 509 aa"
FT                   /db_xref="GOA:Q83ID3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83ID3"
FT                   /protein_id="CAD66774.1"
FT                   /translation="MRPVLVVDFGSQYSQLVVRAIRECGYYAEFASPSISAAECLALSP
FT                   IAIFLSGGPASAYKDNAPKLDEEIFNCGIPIFGICYGFQLLAQAFGGSVKKANAPEYGP
FT                   ADITIVNKAFFSGQPDRQTVWMSHGDSVIRAPKNFCILSTSQDAVLSFCNRDRTIAGVQ
FT                   WHPEVKHSRFGKHTIKAFLSSFAAPNWDPEQTICGTVDSIRKTVGCKRVLCALSGGVDS
FT                   VVAATLTHRAIGDRLRCVFVDHGLLRLNEREQVEEYCSSLGLNVSTYDASDCFLSALSG
FT                   IRDSEQKRKVIGREFIACFSKLQERFDIKPHFLLQGTLYPDLVESGATPGGATIKSHHN
FT                   VGGLSDNLGFELLEPLKYLFKDEVRKIGLQLGIPKHIVHRQPFPGPGLAIRIIGEVTNK
FT                   KLSILRAADAIVRHELRDWTDIWQCPVILLSDVQSVGVRGDSRSCGFPIVIRPVSSDDA
FT                   MTADWYRLPYDVLARISGRITNEIPEIVRVVLDITPKPPATIEWE"
     MRPVLVVDFG SQYSQLVVRA IRECGYYAEF ASPSISAAEC LALSPIAIFL SGGPASAYKD        60
     NAPKLDEEIF NCGIPIFGIC YGFQLLAQAF GGSVKKANAP EYGPADITIV NKAFFSGQPD       120
     RQTVWMSHGD SVIRAPKNFC ILSTSQDAVL SFCNRDRTIA GVQWHPEVKH SRFGKHTIKA       180
     FLSSFAAPNW DPEQTICGTV DSIRKTVGCK RVLCALSGGV DSVVAATLTH RAIGDRLRCV       240
     FVDHGLLRLN EREQVEEYCS SLGLNVSTYD ASDCFLSALS GIRDSEQKRK VIGREFIACF       300
     SKLQERFDIK PHFLLQGTLY PDLVESGATP GGATIKSHHN VGGLSDNLGF ELLEPLKYLF       360
     KDEVRKIGLQ LGIPKHIVHR QPFPGPGLAI RIIGEVTNKK LSILRAADAI VRHELRDWTD       420
     IWQCPVILLS DVQSVGVRGD SRSCGFPIVI RPVSSDDAMT ADWYRLPYDV LARISGRITN       480
     EIPEIVRVVL DITPKPPATI EWE                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page