(data stored in ACNUC30630 zone)

EMBL: BX251410.GUAB1

BX251410.GUAB1       Location/Qualifiers
FT   CDS             83392..84867
FT                   /transl_table=11
FT                   /gene="guaB1"
FT                   /locus_tag="TW085"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="Similar to Bacillus subtilis
FT                   inosine-5'-monophosphate dehydrogenase GuaB or GnaB
FT                   SWALL:IMDH_BACSU (SWALL:P21879) (513 aa) fasta scores: E():
FT                   2.1e-87, 50.92% id in 489 aa"
FT                   /protein_id="CAD66770.1"
FT                   /translation="MHPHKLSGVGLTYDDVMLVPGRSDVLPSQVNFGSFLTRRIRLSAP
FT                   LVSAAMDTVTESGMAVAMARLGGVGVIHRNMSIADQAEHVTRVKLSESGMITRPVSVSP
FT                   DLTLEEVEQRCSRYKISGFPVVDEDNTLLGIVTSRDMWPYRHEHRASVRVSEVMTRSPL
FT                   ITASPNISSEEARDLLYKHRLEKLPLVDEHGRLFGLITVKDFVNRQRYPFATKDKNGCL
FT                   IVGAAIGFFGDAYDRALALAAAGVDFIVVDTANGYSDGALKMINRLKNDSTFADIDIIG
FT                   GNVATGDGAKALIDSGADAVKVGIGPGSICTTRVIAGVGVPQITAIYECAQTSSVPIIA
FT                   DGGLHYSGDIAKALVAGAKSVMLGGLLAGCDESPGELISRGGKQYKIYRGMGSAGAMQA
FT                   RASYSRDRYFQHDLDSHPIAEGVEGQVPHTGSVSTVFYQLLGGLRQSMFYVGCRDINEL
FT                   QDKGRFVRITSAGLKESHPHDIEMIVETPNYRT"
     MHPHKLSGVG LTYDDVMLVP GRSDVLPSQV NFGSFLTRRI RLSAPLVSAA MDTVTESGMA        60
     VAMARLGGVG VIHRNMSIAD QAEHVTRVKL SESGMITRPV SVSPDLTLEE VEQRCSRYKI       120
     SGFPVVDEDN TLLGIVTSRD MWPYRHEHRA SVRVSEVMTR SPLITASPNI SSEEARDLLY       180
     KHRLEKLPLV DEHGRLFGLI TVKDFVNRQR YPFATKDKNG CLIVGAAIGF FGDAYDRALA       240
     LAAAGVDFIV VDTANGYSDG ALKMINRLKN DSTFADIDII GGNVATGDGA KALIDSGADA       300
     VKVGIGPGSI CTTRVIAGVG VPQITAIYEC AQTSSVPIIA DGGLHYSGDI AKALVAGAKS       360
     VMLGGLLAGC DESPGELISR GGKQYKIYRG MGSAGAMQAR ASYSRDRYFQ HDLDSHPIAE       420
     GVEGQVPHTG SVSTVFYQLL GGLRQSMFYV GCRDINELQD KGRFVRITSA GLKESHPHDI       480
     EMIVETPNYR T                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page