(data stored in ACNUC30630 zone)

EMBL: BX251410.GUAB2

BX251410.GUAB2       Location/Qualifiers
FT   CDS             84872..85993
FT                   /transl_table=11
FT                   /gene="guaB2"
FT                   /locus_tag="TW086"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   inosine-5'-monophosphate dehydrogenase SCO4771 or SCD63.03
FT                   SWALL:Q9L0I6 (EMBL:AL161755) (374 aa) fasta scores: E():
FT                   7.1e-82, 58.64% id in 370 aa, and to Escherichia coli and
FT                   Escherichia coli O157:H7 inosine-5'-monophosphate
FT                   dehydrogenase GuaB or b2508 or z3772 or ecs3370
FT                   SWALL:IMDH_ECOLI (SWALL:P06981) (488 aa) fasta scores: E():
FT                   7.5e-05, 32.94% id in 170 aa"
FT                   /protein_id="CAD66771.1"
FT                   /translation="MEVGFSRNARRAFSLDEVAVVPSRRTRHSSEVSIEWKMDAFSFDT
FT                   PIISSPADSVVSPSTIVELSEFGCLGILDLEGVWTRYENPEPVLREISALPEEKACLGL
FT                   QKIYSEPIKRHLLERRLQELRDAGVIVAGCLSPQTTNALYKSVISAGVDIFVIRGGTVS
FT                   AEHVSKSDNVLNLKRFIYELDVPVMVGGVATYTAALHMMRTGAAGVLVGFGGCAGSTNH
FT                   ASLGIKVPMATAIADVAAARKDYLDESGGRYVQVIADGSMNTSGMAVNALALGADAVMM
FT                   GTPLVRSTTSPGFGYHWGREAHHMTLPRGRRAYIGQTASLQEIIQGPGHSPDGTVNFAG
FT                   AIRRAVALAGFQDLKNFQRVEMVVIQDQRRCCA"
     MEVGFSRNAR RAFSLDEVAV VPSRRTRHSS EVSIEWKMDA FSFDTPIISS PADSVVSPST        60
     IVELSEFGCL GILDLEGVWT RYENPEPVLR EISALPEEKA CLGLQKIYSE PIKRHLLERR       120
     LQELRDAGVI VAGCLSPQTT NALYKSVISA GVDIFVIRGG TVSAEHVSKS DNVLNLKRFI       180
     YELDVPVMVG GVATYTAALH MMRTGAAGVL VGFGGCAGST NHASLGIKVP MATAIADVAA       240
     ARKDYLDESG GRYVQVIADG SMNTSGMAVN ALALGADAVM MGTPLVRSTT SPGFGYHWGR       300
     EAHHMTLPRG RRAYIGQTAS LQEIIQGPGH SPDGTVNFAG AIRRAVALAG FQDLKNFQRV       360
     EMVVIQDQRR CCA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page