(data stored in ACNUC30630 zone)

EMBL: BX251410.GYRA1

BX251410.GYRA1       Location/Qualifiers
FT   CDS             6438..8897
FT                   /transl_table=11
FT                   /gene="gyrA1"
FT                   /locus_tag="TW006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Streptomyces coelicolor DNA gyrase
FT                   subunit A GyrA or SCO3873 or SCH18.10c SWALL:GYRA_STRCO
FT                   (SWALL:P35885) (857 aa) fasta scores: E(): 1.8e-189, 61.26%
FT                   id in 808 aa"
FT                   /protein_id="CAD66698.1"
FT                   /translation="MSEQNINQVDLREEMQRSYLDYAMSVIIGRALPDVRDGLKPVHRR
FT                   VLYAMYKGGYRPEKAFSKCARVVGDVMGQFHPHGDAAIYDALVRLVQPWAMRYPLAQGQ
FT                   GNFGSPGNDGAAAPRYTETKMATLAIEMVRDIDEDTVDFSPNYDGESVEPTVMPCRFPN
FT                   LLVNGSVGIAVGMATNIPPHNLAEVSAGALWCLENPDATDEELTEALLERIKGPDFPTG
FT                   ATVLDTGGIKDAYLTGRGSVVMRGVVDIEEIDGRTCLVVRELPYQVNPDNLALKIASLV
FT                   KENKLSGIADIRDETSGRTGQRLIIVLKRDAVARVVLNSLYKHTQLQENFGVNMLAIVD
FT                   GAPRTLSLCSFIRLWVEHQIEVIVRRTTFRLARAEQRAHILRAYLRALDQIDEVIQLIR
FT                   SSKSAEEAQSNLMALLKIDETQARAILDLQLRRLAALERQRIISEAREIEELISSFRKI
FT                   LSDKTAQCQVIAEELREIGQKHSDARRTEIIRGFDGSVSIEDLIPVEPVVVVMTRCGYI
FT                   KRTRIDQYRSQHRGGRGVKGAQVKADDVVLQFISTTTHNWLMFFTNTGRVYRAKAYEVP
FT                   EASREARGQHVANLLPLKPNEAVTRILSVSNFDSEDTSLVLATKDGYVKKTTLKEYDTS
FT                   LSTGVIAIKLRPGDKLVSAVLARSDQDIILVTKNARSLRFKSGTLRPLSRGSYGVKGIS
FT                   LRENDLLLSAELILSDDSYIFVVSERGYAKRSRVGDYKLQARGGIGVRVANITEQKGVL
FT                   ADMLVVNDDDEVLVILASGKVIRSSVAEVSPTLRYTTGVVFVRMSDGDKILAMTIAEKC
FT                   DDLEGQG"
     MSEQNINQVD LREEMQRSYL DYAMSVIIGR ALPDVRDGLK PVHRRVLYAM YKGGYRPEKA        60
     FSKCARVVGD VMGQFHPHGD AAIYDALVRL VQPWAMRYPL AQGQGNFGSP GNDGAAAPRY       120
     TETKMATLAI EMVRDIDEDT VDFSPNYDGE SVEPTVMPCR FPNLLVNGSV GIAVGMATNI       180
     PPHNLAEVSA GALWCLENPD ATDEELTEAL LERIKGPDFP TGATVLDTGG IKDAYLTGRG       240
     SVVMRGVVDI EEIDGRTCLV VRELPYQVNP DNLALKIASL VKENKLSGIA DIRDETSGRT       300
     GQRLIIVLKR DAVARVVLNS LYKHTQLQEN FGVNMLAIVD GAPRTLSLCS FIRLWVEHQI       360
     EVIVRRTTFR LARAEQRAHI LRAYLRALDQ IDEVIQLIRS SKSAEEAQSN LMALLKIDET       420
     QARAILDLQL RRLAALERQR IISEAREIEE LISSFRKILS DKTAQCQVIA EELREIGQKH       480
     SDARRTEIIR GFDGSVSIED LIPVEPVVVV MTRCGYIKRT RIDQYRSQHR GGRGVKGAQV       540
     KADDVVLQFI STTTHNWLMF FTNTGRVYRA KAYEVPEASR EARGQHVANL LPLKPNEAVT       600
     RILSVSNFDS EDTSLVLATK DGYVKKTTLK EYDTSLSTGV IAIKLRPGDK LVSAVLARSD       660
     QDIILVTKNA RSLRFKSGTL RPLSRGSYGV KGISLRENDL LLSAELILSD DSYIFVVSER       720
     GYAKRSRVGD YKLQARGGIG VRVANITEQK GVLADMLVVN DDDEVLVILA SGKVIRSSVA       780
     EVSPTLRYTT GVVFVRMSDG DKILAMTIAE KCDDLEGQG                              819
//

If you have problems or comments...

PBIL Back to PBIL home page