(data stored in ACNUC30630 zone)

EMBL: BX251410.GYRB1

BX251410.GYRB1       Location/Qualifiers
FT   CDS             4485..6434
FT                   /transl_table=11
FT                   /gene="gyrB1"
FT                   /locus_tag="TW005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Bacillus halodurans DNA gyrase subunit B
FT                   GtrB or BH0006 SWALL:GYRB_BACHD (SWALL:O50627) (637 aa)
FT                   fasta scores: E(): 1.1e-136, 56.74% id in 645 aa"
FT                   /protein_id="CAD66697.1"
FT                   /translation="MVDTPEPAYGADQIQVLEGLEAVRRRPGMYIGSTGSRGLHHLVYE
FT                   LVDNSVDEALAGYCTKINVAILADGGVRVTDNGRGIPVDIHPKEGVSTVQVVLTTLHAG
FT                   GKFGSGGYSVSGGLHGVGSSVVNALSKRLYVEVSRQGFVFRQNYEGGNPTAALERCEET
FT                   NATGTAITFWPDDDIFETVCFEYEVLRSRLQQMAFLNSGLTVSITDERVDSPTNNETYC
FT                   YQNGLFDYVMYQNRIRKHEPLHEEIIHFQAENKDRLMSLEVAMRWTSSSTENIYTFANT
FT                   INTHEGGTHEEGFRAALTSLVNRYAREKGFLKEKDESLQGEDIREGLTAIISVKLGEPQ
FT                   FEGQTKTKLGNTEMRGYVHHEVNSYLWDWFDSHPAQAKVIISKALLAAEARLAAKRARE
FT                   ASRKRGLFESVSMPGKLKECQAKDPAVSELFIVEGDSAGGSAIQGRDPLTQAVLPLRGK
FT                   ILNVEKARLDKAIANSEIQAMLTAFGSGIAEDFDESKARYHKIILMSDADVDGQHITTL
FT                   LLTLLFRYMRPLIESGYVYLAHPPLYRIKWSNSEHDYVFSDRERDKKLAEGKLSGKKIP
FT                   KENAIQRYKGLGEMNYRELWDTTMNPATRTLRQITVDDVTLADEIFSVLMGEDVDSRRK
FT                   FIQHNARDVRFLDI"
     MVDTPEPAYG ADQIQVLEGL EAVRRRPGMY IGSTGSRGLH HLVYELVDNS VDEALAGYCT        60
     KINVAILADG GVRVTDNGRG IPVDIHPKEG VSTVQVVLTT LHAGGKFGSG GYSVSGGLHG       120
     VGSSVVNALS KRLYVEVSRQ GFVFRQNYEG GNPTAALERC EETNATGTAI TFWPDDDIFE       180
     TVCFEYEVLR SRLQQMAFLN SGLTVSITDE RVDSPTNNET YCYQNGLFDY VMYQNRIRKH       240
     EPLHEEIIHF QAENKDRLMS LEVAMRWTSS STENIYTFAN TINTHEGGTH EEGFRAALTS       300
     LVNRYAREKG FLKEKDESLQ GEDIREGLTA IISVKLGEPQ FEGQTKTKLG NTEMRGYVHH       360
     EVNSYLWDWF DSHPAQAKVI ISKALLAAEA RLAAKRAREA SRKRGLFESV SMPGKLKECQ       420
     AKDPAVSELF IVEGDSAGGS AIQGRDPLTQ AVLPLRGKIL NVEKARLDKA IANSEIQAML       480
     TAFGSGIAED FDESKARYHK IILMSDADVD GQHITTLLLT LLFRYMRPLI ESGYVYLAHP       540
     PLYRIKWSNS EHDYVFSDRE RDKKLAEGKL SGKKIPKENA IQRYKGLGEM NYRELWDTTM       600
     NPATRTLRQI TVDDVTLADE IFSVLMGEDV DSRRKFIQHN ARDVRFLDI                   649
//

If you have problems or comments...

PBIL Back to PBIL home page