(data stored in ACNUC30630 zone)

EMBL: BX251410.HPT

BX251410.HPT         Location/Qualifiers
FT   CDS             213482..213985
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="TW172"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="Similar to Salmonella typhimurium hypoxanthine
FT                   phosphoribosyltransferase Hpt or Stm0170 SWALL:HPRT_SALTY
FT                   (SWALL:O33799) (178 aa) fasta scores: E(): 7.7e-25, 46.01%
FT                   id in 163 aa, and to Streptomyces coelicolor putative
FT                   hypoxanthine phosphoribosyltransferase HprT or SCO3405 or
FT                   SCE9.12c SWALL:Q9X8I5 (EMBL:AL049841) (187 aa) fasta
FT                   scores: E(): 7.9e-35, 54.81% id in 166 aa"
FT                   /protein_id="CAD66851.1"
FT                   /translation="MKPLLSEAVIHRRLAQLALQIDEDYRGTSIVLLGVLKGSIMLMAD
FT                   LSRLLSSDLRIEWVTLSSYGNDTVSSGSIRIVHDLDADIRDRHVLIIEDIVDSGLTLGW
FT                   LLAKMRERRPASIEACVLLRKPHARGTDVRYLGFDIPDEFVIGYGMDYAEKYRNLKSVY
FT                   VLEQ"
     MKPLLSEAVI HRRLAQLALQ IDEDYRGTSI VLLGVLKGSI MLMADLSRLL SSDLRIEWVT        60
     LSSYGNDTVS SGSIRIVHDL DADIRDRHVL IIEDIVDSGL TLGWLLAKMR ERRPASIEAC       120
     VLLRKPHARG TDVRYLGFDI PDEFVIGYGM DYAEKYRNLK SVYVLEQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page