(data stored in ACNUC30630 zone)

EMBL: BX251410.HRDB

BX251410.HRDB        Location/Qualifiers
FT   CDS             296144..297307
FT                   /transl_table=11
FT                   /gene="hrdB"
FT                   /locus_tag="TW263"
FT                   /product="RNA polymerase principal sigma factor hrdb"
FT                   /note="Similar to Streptomyces coelicolor RNA polymerase
FT                   principal sigma factor HrdB or SCO5820 or SC5B8.10
FT                   SWALL:HRDB_STRCO (SWALL:P18183) (511 aa) fasta scores: E():
FT                   2.2e-90, 68.31% id in 385 aa"
FT                   /protein_id="CAD66939.1"
FT                   /translation="MPVKIKTQSRGSDKEAFAGAPSTSGASGAVLDEDLSTDPASHISA
FT                   QATASDTDVASQGSEGDFEAIVLADTKDDESTPASPVISGATADPVKDYLKQIGKVSLL
FT                   TADEEVSLAKRIEAGLFAEEKLSESGDLAPKLKRELRWVVRDGQRAKDHLLAANLRLVV
FT                   SLAKRYTGRGMQFLDLIQEGNLGLIRAVEKFDYVKGFKFSTYATWWIRQAITRAMADQA
FT                   RTIRIPVHMVEVINKLSRVQRQLLQDLGREPTPDELGRELDMPPERVVEVQKYGREPIS
FT                   LHTPLGDEGDSEFGDLIEDVDAVAPDDAVGFSMLQQQLRLLLDSLSEREAGVIRMRFGL
FT                   DYDMPKTLDYVGEYFDVTRERIRQIEAKTMAKLRHPSRSQCLRDYLG"
     MPVKIKTQSR GSDKEAFAGA PSTSGASGAV LDEDLSTDPA SHISAQATAS DTDVASQGSE        60
     GDFEAIVLAD TKDDESTPAS PVISGATADP VKDYLKQIGK VSLLTADEEV SLAKRIEAGL       120
     FAEEKLSESG DLAPKLKREL RWVVRDGQRA KDHLLAANLR LVVSLAKRYT GRGMQFLDLI       180
     QEGNLGLIRA VEKFDYVKGF KFSTYATWWI RQAITRAMAD QARTIRIPVH MVEVINKLSR       240
     VQRQLLQDLG REPTPDELGR ELDMPPERVV EVQKYGREPI SLHTPLGDEG DSEFGDLIED       300
     VDAVAPDDAV GFSMLQQQLR LLLDSLSERE AGVIRMRFGL DYDMPKTLDY VGEYFDVTRE       360
     RIRQIEAKTM AKLRHPSRSQ CLRDYLG                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page