(data stored in ACNUC30630 zone)

EMBL: BX251410.HUP

BX251410.HUP         Location/Qualifiers
FT   CDS             132298..132579
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="TW128"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /note="Similar to Escherichia coli DNA-binding protein
FT                   HU-alpha HupA or b4000 or z5576 or ecs4923 SWALL:DBHA_ECOLI
FT                   (SWALL:P02342) (90 aa) fasta scores: E(): 7.7e-08, 37.77%
FT                   id in 90 aa, and to Streptomyces coelicolor, and
FT                   Streptomyces lividans DNA-binding protein HU 1 Hup1 or Hup
FT                   or SCO2950 or SCE59.09 SWALL:DBH1_STRCO (SWALL:O06447) (93
FT                   aa) fasta scores: E(): 5.1e-13, 50.54% id in 91 aa"
FT                   /protein_id="CAD66808.1"
FT                   /translation="MVSLNRTELVAKVAETSGVSRATVNSVIEETFAVFAETVRAGGKV
FT                   TIPGWCSVTRSHRAARTGRNPQTGKTVEIPAGYSVRIAPGSKLKAAVK"
     MVSLNRTELV AKVAETSGVS RATVNSVIEE TFAVFAETVR AGGKVTIPGW CSVTRSHRAA        60
     RTGRNPQTGK TVEIPAGYSV RIAPGSKLKA AVK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page