(data stored in ACNUC30630 zone)

EMBL: BX251410.IDER

BX251410.IDER        Location/Qualifiers
FT   CDS             130688..131341
FT                   /transl_table=11
FT                   /gene="ideR"
FT                   /locus_tag="TW124"
FT                   /product="iron-dependent repressor"
FT                   /note="Similar to Mycobacterium tuberculosis iron-dependent
FT                   repressor IdeR or DtxR or Rv2711 or mt2784 or mtcy05a6.32
FT                   SWALL:IDER_MYCTU (SWALL:Q50495) (230 aa) fasta scores: E():
FT                   6.4e-29, 42.98% id in 221 aa, and to Streptomyces lividans
FT                   and Streptomyces coelicolor iron repressor DesR or DmdR1 or
FT                   SCO4394 or SCD10.26 SWALL:Q54343 (EMBL:Z50049) (230 aa)
FT                   fasta scores: E(): 3.8e-32, 47.23% id in 199 aa"
FT                   /protein_id="CAD66804.1"
FT                   /translation="MYLRTIVNLEEEGISPIIKARISERIGHTAPTVFQTIARMQRDGL
FT                   LVVSSNKSLILTSKGRKIALSVVRKHRLAEVLLHDVVGLEWEHIHLEACRLEHVMSDHL
FT                   EEHLRRILNNPSFTTYGTPIPPADSDFVEPFRDVISLSRAVIRQKARKLSVRCLGEIAQ
FT                   QDTILLSQLSKAGLRPGGLGSFMDSQNGILSWTNSGNKFIISHYIAECIFVNQN"
     MYLRTIVNLE EEGISPIIKA RISERIGHTA PTVFQTIARM QRDGLLVVSS NKSLILTSKG        60
     RKIALSVVRK HRLAEVLLHD VVGLEWEHIH LEACRLEHVM SDHLEEHLRR ILNNPSFTTY       120
     GTPIPPADSD FVEPFRDVIS LSRAVIRQKA RKLSVRCLGE IAQQDTILLS QLSKAGLRPG       180
     GLGSFMDSQN GILSWTNSGN KFIISHYIAE CIFVNQN                                217
//

If you have problems or comments...

PBIL Back to PBIL home page