(data stored in ACNUC30630 zone)

EMBL: BX251410.INFA

BX251410.INFA        Location/Qualifiers
FT   CDS             255844..256065
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="TW228"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Similar to Escherichia coli translation initiation
FT                   factor IF-1 InfA or b0884 or z1228 or ecs0969 or stm0953 or
FT                   sty0951 SWALL:IF1_ECOLI (SWALL:P02998) (71 aa) fasta
FT                   scores: E(): 3.7e-16, 65.27% id in 72 aa"
FT                   /db_xref="GOA:Q83I58"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I58"
FT                   /protein_id="CAD66905.1"
FT                   /translation="MAKKDGVIELEGSVLEALPNATFRVELSNGHKVLAHISGRMRQHY
FT                   IRILPEDRVVVELSPYDLARGRIVYRYK"
     MAKKDGVIEL EGSVLEALPN ATFRVELSNG HKVLAHISGR MRQHYIRILP EDRVVVELSP        60
     YDLARGRIVY RYK                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page