(data stored in ACNUC30630 zone)

EMBL: BX251410.ISPE

BX251410.ISPE        Location/Qualifiers
FT   CDS             complement(187878..189107)
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="TW159"
FT                   /product="4-diphosphocytidyl-2-c-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="Similar to Escherichia coli
FT                   4-diphosphocytidyl-2-c-methyl-D-erythritol kinase IspE or
FT                   Ipk or b1208 or z1979 or ecs1713 SWALL:ISPE_ECOLI
FT                   (SWALL:P24209) (283 aa) fasta scores: E(): 7.7e-07, 28.95%
FT                   id in 221 aa, and to Streptomyces coelicolor
FT                   4-diphosphocytidyl-2-c-methyl-D-erythritol kinase IspE or
FT                   SCO3148 or SCE66.27c SWALL:ISPE_STRCO (SWALL:Q9K3R6) (299
FT                   aa) fasta scores: E(): 5.9e-21, 39.07% id in 238 aa. Note
FT                   possible alternative translational start sites."
FT                   /db_xref="GOA:Q83IA0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA0"
FT                   /protein_id="CAD66839.1"
FT                   /translation="MKTDGGNTWRASHSKPLNTANTMGEPFSHSEYSVHADQSEFYLNE
FT                   LTEHSGQDNPCMNTSRLNTNRYGHPVVHPCPKIHCICTQSNIAAIGSDCTGCVDIAQAC
FT                   KMLRGGQGCTQDPCVKNPHTQCFTDVSNHAMRNVLPLNVSNTEQFPIQIEYANGRNPVL
FT                   NPMDDLAMRAALLLSKDIDLQNTHILPSTRISIEKNIPVAAGLAGGSADAAAVLLGINS
FT                   AWQTNYSRCDLLGKAGALGADVPFLIWGGAAYGSGTGSCVTFFETQTLYWVLCFSKHPL
FT                   STRKVFQELDRQRSGAGCNHHPVFSNPAECAEMLKKAIKRGPEALAALLHNDLTSAAKM
FT                   LMPEIAERIKAAERCPGILRAIISGSGPTLALLAEDAEAANRACSILKDTGVICKAVSS
FT                   PAYSSIYWQT"
     MKTDGGNTWR ASHSKPLNTA NTMGEPFSHS EYSVHADQSE FYLNELTEHS GQDNPCMNTS        60
     RLNTNRYGHP VVHPCPKIHC ICTQSNIAAI GSDCTGCVDI AQACKMLRGG QGCTQDPCVK       120
     NPHTQCFTDV SNHAMRNVLP LNVSNTEQFP IQIEYANGRN PVLNPMDDLA MRAALLLSKD       180
     IDLQNTHILP STRISIEKNI PVAAGLAGGS ADAAAVLLGI NSAWQTNYSR CDLLGKAGAL       240
     GADVPFLIWG GAAYGSGTGS CVTFFETQTL YWVLCFSKHP LSTRKVFQEL DRQRSGAGCN       300
     HHPVFSNPAE CAEMLKKAIK RGPEALAALL HNDLTSAAKM LMPEIAERIK AAERCPGILR       360
     AIISGSGPTL ALLAEDAEAA NRACSILKDT GVICKAVSSP AYSSIYWQT                   409
//

If you have problems or comments...

PBIL Back to PBIL home page