(data stored in ACNUC30630 zone)

EMBL: BX251410.LSPA

BX251410.LSPA        Location/Qualifiers
FT   CDS             277872..278324
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="TW250"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="Similar to Staphylococcus aureus lipoprotein signal
FT                   peptidase LspA or Lsp SWALL:LSPA_STAAU (SWALL:P31024) (163
FT                   aa) fasta scores: E(): 1.9e-07, 35.82% id in 134 aa, and to
FT                   Bacillus halodurans lipoprotein signal peptidase LspA or
FT                   Lsp or bh2543 SWALL:LSPA_BACHD (SWALL:Q9K9V2) (156 aa)
FT                   fasta scores: E(): 3.5e-09, 36.48% id in 148 aa"
FT                   /db_xref="GOA:Q83I41"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I41"
FT                   /protein_id="CAD66926.1"
FT                   /translation="MTTRTLRFYALVGFLVFLDQVTKYLAHAYLARDFIVIPNLFRLTL
FT                   AKNSGAAFSFGTGFSWLFFLLGIIALIFIGWFLPRTTGSIVFLALLQGGIAGNVFDRLF
FT                   KPPYFGNGEVVDFLNTPLFSGVVFNIADLFILAGVFGTFLFLKGSK"
     MTTRTLRFYA LVGFLVFLDQ VTKYLAHAYL ARDFIVIPNL FRLTLAKNSG AAFSFGTGFS        60
     WLFFLLGIIA LIFIGWFLPR TTGSIVFLAL LQGGIAGNVF DRLFKPPYFG NGEVVDFLNT       120
     PLFSGVVFNI ADLFILAGVF GTFLFLKGSK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page