(data stored in ACNUC30630 zone)

EMBL: BX251410.LYSS

BX251410.LYSS        Location/Qualifiers
FT   CDS             complement(62943..64580)
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="TW072"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Similar to Pyrococcus horikoshii lysyl-tRNA
FT                   synthetase LysS or ph0224 SWALL:SYK_PYRHO (SWALL:O57963)
FT                   (523 aa) fasta scores: E(): 2e-56, 33.2% id in 530 aa"
FT                   /protein_id="CAD66759.1"
FT                   /translation="MTASRIDAASPEKYGKQDWVSKLAEQVIQERKGDKKIVVASGISP
FT                   SGQIHLGNLREVITGHFIADEISSRGFDCEHILSWDDFDRLRKVPANIDKGYEQYIGMP
FT                   LCDVPPPAGSKKNSWSEHFRGDFEKTMEILGIKVRHISQSQMYRSGAYTHNILLALEKR
FT                   HEIQNIIGKYQSKKTQPAESPREYYPYVVYCTRCKKDLTQIEDFAGSELSYSCKCGHSE
FT                   TIGIGEFNNGKLPWKVDWPMRWMYESVDFEPGGVDHCSPGSASLSASSDIANQIFNWTP
FT                   PLTVMYSFVGVQGHAKMSSSTGNVLTPNDALSVMEPTLLRWMYARRKPNQSFTVGFDQS
FT                   LQRLYDEWDSLPNDLTGCELASSYTRAMSTTNKRFNAPEILISFRTLVSLIDISASDDS
FT                   QLLRMVKNLRPDIRSLAQLEPRLSCARIYSKKFSNPIHVLQTPNKQVLHTAAPNVREML
FT                   RIFIDGLDKNWSIEKLTTLAYGVPKVVLGIDQSSKDVSQEVKNLQKEFFRTIYQLVIGQ
FT                   DKGPRLPTLLMAIGKQSTRALLCSCETC"
     MTASRIDAAS PEKYGKQDWV SKLAEQVIQE RKGDKKIVVA SGISPSGQIH LGNLREVITG        60
     HFIADEISSR GFDCEHILSW DDFDRLRKVP ANIDKGYEQY IGMPLCDVPP PAGSKKNSWS       120
     EHFRGDFEKT MEILGIKVRH ISQSQMYRSG AYTHNILLAL EKRHEIQNII GKYQSKKTQP       180
     AESPREYYPY VVYCTRCKKD LTQIEDFAGS ELSYSCKCGH SETIGIGEFN NGKLPWKVDW       240
     PMRWMYESVD FEPGGVDHCS PGSASLSASS DIANQIFNWT PPLTVMYSFV GVQGHAKMSS       300
     STGNVLTPND ALSVMEPTLL RWMYARRKPN QSFTVGFDQS LQRLYDEWDS LPNDLTGCEL       360
     ASSYTRAMST TNKRFNAPEI LISFRTLVSL IDISASDDSQ LLRMVKNLRP DIRSLAQLEP       420
     RLSCARIYSK KFSNPIHVLQ TPNKQVLHTA APNVREMLRI FIDGLDKNWS IEKLTTLAYG       480
     VPKVVLGIDQ SSKDVSQEVK NLQKEFFRTI YQLVIGQDKG PRLPTLLMAI GKQSTRALLC       540
     SCETC                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page