(data stored in ACNUC30630 zone)

EMBL: BX251410.MANB

BX251410.MANB        Location/Qualifiers
FT   CDS             146782..148212
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="TW137"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="Similar to Escherichia coli phosphomannomutase ManB
FT                   or RfbK or RfbK2 SWALL:RFK9_ECOLI (SWALL:P37755) (456 aa)
FT                   fasta scores: E(): 4.3e-48, 34.44% id in 450 aa, and to
FT                   Streptomyces coelicolor phosphomannomutase ManB or SCO3028
FT                   or SCE34.09c SWALL:Q9KZL6 (EMBL:AL353862) (454 aa) fasta
FT                   scores: E(): 6.8e-88, 51.96% id in 458 aa"
FT                   /protein_id="CAD66817.1"
FT                   /translation="MPQRGGLCSSIHSYSGRSVSVFKAYDVRGLVPEQLTTDISRAIGA
FT                   AYIDSLGCSSIVVGRDMRPSSKELFYAFAEGCTARGASVIDIGLCSTDAVYYASGAWNI
FT                   PAAVFTASHNPPEYNGIKFCRPGAQGIGYTTGLSDVEKISDKYLLKGIPHAETKGKVVK
FT                   KSVGREYAEYICNLVGPLQKPLKVVIDAGNGMAGKMVPIVMQSALTDIEILPLYFELDG
FT                   TFPNHEANPFDPKNLVDLQHAVKETGADIGLAFDGDADRCVVIDEMSNPVTPSSIASIV
FT                   VGRILKQYGNAKATIVHNLLVSRGFAESVISRNSENRLVRTRVGHSFIKDIMHKTNALF
FT                   GCEHSAHYYFRDFWGADNGMLAALYVMAELCESPMPMSVLSRKYTPYFQSGETNYRVHN
FT                   PDMTMSAIRQAFPGAYVEFLDGMTLYESVKDPGPERFWWLNVRKSNTEPLLRLNVEAQT
FT                   EDLMRLVRDKAVKIITGG"
     MPQRGGLCSS IHSYSGRSVS VFKAYDVRGL VPEQLTTDIS RAIGAAYIDS LGCSSIVVGR        60
     DMRPSSKELF YAFAEGCTAR GASVIDIGLC STDAVYYASG AWNIPAAVFT ASHNPPEYNG       120
     IKFCRPGAQG IGYTTGLSDV EKISDKYLLK GIPHAETKGK VVKKSVGREY AEYICNLVGP       180
     LQKPLKVVID AGNGMAGKMV PIVMQSALTD IEILPLYFEL DGTFPNHEAN PFDPKNLVDL       240
     QHAVKETGAD IGLAFDGDAD RCVVIDEMSN PVTPSSIASI VVGRILKQYG NAKATIVHNL       300
     LVSRGFAESV ISRNSENRLV RTRVGHSFIK DIMHKTNALF GCEHSAHYYF RDFWGADNGM       360
     LAALYVMAEL CESPMPMSVL SRKYTPYFQS GETNYRVHNP DMTMSAIRQA FPGAYVEFLD       420
     GMTLYESVKD PGPERFWWLN VRKSNTEPLL RLNVEAQTED LMRLVRDKAV KIITGG           476
//

If you have problems or comments...

PBIL Back to PBIL home page