(data stored in ACNUC30630 zone)

EMBL: BX251410.MDMC

BX251410.MDMC        Location/Qualifiers
FT   CDS             complement(228948..229565)
FT                   /transl_table=11
FT                   /gene="mdmC"
FT                   /locus_tag="TW190"
FT                   /product="putative O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Streptomyces mycarofaciens
FT                   O-methyltransferase MdmC SWALL:MDMC_STRMY (SWALL:Q00719)
FT                   (221 aa) fasta scores: E(): 8e-05, 28.57% id in 175 aa"
FT                   /protein_id="CAD66867.1"
FT                   /translation="MKAEINWNFTQSLPKDTEEEKHLRLLSEELYIQSICPAIGAHIKT
FT                   QVAALPAPQVLEIGTGIGLSALKMVSVNRKAHITTIEVNPDFYNRAKNNLTNYFSCLRF
FT                   INSNALEVIPRMNRNMYDLVLIDANPRDVLNYFELALGVVKSGGAILVPHALWQGKVAS
FT                   PVYKDEPEISFRALIHEVVNSETFVSCLSPIGDGILTVTKPK"
     MKAEINWNFT QSLPKDTEEE KHLRLLSEEL YIQSICPAIG AHIKTQVAAL PAPQVLEIGT        60
     GIGLSALKMV SVNRKAHITT IEVNPDFYNR AKNNLTNYFS CLRFINSNAL EVIPRMNRNM       120
     YDLVLIDANP RDVLNYFELA LGVVKSGGAI LVPHALWQGK VASPVYKDEP EISFRALIHE       180
     VVNSETFVSC LSPIGDGILT VTKPK                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page